PRGDB00049951 (Os08g0543100)

From PRG Wiki
Revision as of 17:09, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Os08g0543100
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115477604 (NM_001068933)
Gene Class NL
Domain Type LRR, NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os08g0543100 (Os08g0543100) mRNA, complete cds.

DNA Sequence

ATGGCAGAATCGCTGCTCCTCCCGGTGGTGCGCGGGGTGGTCGGCAAGGCGGCCGGCGCGCTCGTCCAGAGCGTCACTCGCATGTGCGGCGTCGACGGCGATCGCCACAAGCTGGAGCGCCAGCTTCTGGCCGTCCAGTGCAAGCTGTCCGACGCCGAGGCGAAGAGCGAGACCAGCCCCGCCGTGAAGAGGTGGATGAAGGACCTCAAGGCCGTCGCGTACGAGGCCGACGACGTCCTCGACGACTTCCACTACGAGGCACTGCGCCGCGACGCCCAGATCGGCGACTCCACCACCGACAAGGTACTCGGCTACTTCACGCCGCACAGCCCCCTCCTGTTCCGTGTTGCCATGAGCAAGAAGCTGAACAGTGTCCTCAAGAAGATCAACGAGCTGGTTGAAGAGATGAACAAGTTTGGCCTAGTGGAGCGTGCAGATCAGGCAACAGTACATGTGATCCATCCTCAGACGCACTCCGGCCTCGATAGCTTGATGGAGATCGTTGGCAGAGACGACGACAAGGAGATGGTGGTGAATTTGTTACTTGAGCAGCGATCCAAGCGGATGGTTGAGGTGCTATCAATCGTAGGGATGGGGGGATTGGGCAAGACCACACTTGCGAAGATGGTGTACAACGACACAAGGGTTCAACAACGCTTTGAGTTGCCCATGTGGCTCTGTGTCTCAGATGATTTCAATGTTGTTTCTCTAGTCAGATCCATTATTGAATTGGCTACCAGGGGAAATTGCACCTTGCCAGACAGAATCGAACTATTGCGCAGCCGTCTACATGAGGTGGTAGGCCGCAAAAGGTATCTACTTGTTCTTGATGATGTTTGGAATGAGGAGGAACATAAATGGGAGGAGCTGAGGCCATTGCTGCATTCTGCTGGTGCTCCAGGAAGTGTAGTACTTGTCACAACTCGGAGCCAGCGGGTAGCATCCATAATGGGCACAGTTCCTGCTCACACGCTATCATACCTAAACCATGATGATTCATGGGAATTATTCCGGAAGAAAGCATTCAGTAAAGAAGAGGAGCAGCAGCCAGAGTTTGCAGAGATTGGCAATCGTATTGTCAAGAAGTGCAAAGGGTTACCTCTTGCTCTGAAGACAATGGGAGGCCTTATGAGTTCCAAGAAGCGAATCCAGGAATGGGAAGCTATTGCAGGAAGCAAGAGTTGGGAGGATGTTGGGACTACAAATGAGATCCTATCCATACTAAAACTGAGCTATAGGCACTTACCACTTGAAATGAAGCAATGTTTTGCCTTTTGCGCAATCTTCCCAAAGGACTACCAGATGGAGAGGGACAAGTTGGTCCAGCTCTGGATAGCGAATAATTTCATCCAAGAGGAGGGGATGATGGATTTGGAAGAGAGAGGACAGTTTGTTTTCAATGAGCTAGTGTGGAGGTCCTTCTTCCAAGATGTAAAGGTAGAAAGTTTTCATGTCGGGATTAAACAGACTTACAAGTCAATTACATGCTACATGCATGATCTAATGCATGATCTAGCAAAATCTGTCACAGAGGAATGTGTTGATGCGCAAGACCTGAACCAGCAAAAAGCCTCGATGAAAGATGTCCGCCATCTGATGTCAAGTGCCAAGTTGCAAGAGAACAGTGAATTATTTAAACATGTGGGACCTCTTCACACATTATTGTCACCATATTGGTCAAAATCATCACCACTACCCAGAAATATCAAGAGATTAAACTTGACGTCTTTACGAGCATTGCATAATGATAAATTGAATGTTTCTCCAAAGGCATTAGCAAGTATAACACACTTACGATACCTTGATCTTTCTCATTCTAGTAAGCTAGAACATTTACCTGATTCAATATGTATGTTATACAGCTTGCAAGCTTTGAGGTTAAATGGTTGCTTGAAACTTCAGCATTTACCAGAGGGTATGAGATTTATGAGCAAGCTCAGGCACCTTTATCTTATTGGTTGTCATAGCTTGAAACGCATGCCACCAAGAATTGGTCAGCTAAAGAACCTCCGGACTCTTACCACATTTGTTGTGGATACCAAAGATGGATGTGGGCTTGAAGAACTGAAAGACTTGCATCATCTAGGTGGCCGACTAGAACTGTTTAATCTGAAAGCTATACAAAGTGGGTCAAATGCAAGAGAAGCCAATCTCCATATCCAAGAAAATGTAACTGAGTTGTTGTTGCACTGGTGTCATGATATATTCGAGTACAGTGACCATGACTTTGATCTCGATGTTGTTGACAACAAAAAGGAGATCGTAGAGTTCTCTTTACCTCCTAGCAGACTTGAAACATTGCAGGTATGGGGCTCTGGTCATATTGAAATGTCATCATGGATGAAAAACCCCGCAATTTTCCTATGCCTAAAAGAACTCCACATGTCTGAGTGCTGGAGATGTAAGGATCTACCACCGTTATGGCAGTCTGTCTCTCTTGAGTCCCTGTCTTTATCCCGTTTGGATAATTTGACCACATTATCTAGTGGCATTGACATGGCTGTTCCAGGATGCAATGGTTCCCTGGAAATTTTTCCAAAGCTGAAGAAGATGCATTTACATTACTTACCTAACTTGGAGAAATGGATGGACAATGAAGTAACATCGGTGATGTTCCCTGAGCTCAAAGAATTAAAAATTTACAATTGTCCAAAGCTAGTGAATATTCCAAAAGCTCCTATCCTACGAGAGCTGGATATATTCCAGTGCAGAATTGCACTGAACTCACTCAGCCATCTTGCAGCACTTTCCCAACTCAACTATGTTGGTGACTGGAGTGTTTCTAAGGATTTGCAGGTAATACCAATACGCTCCTGGCCATCTCTTGTGACATTAGCGCTAGCCTCTTTAGGGAACTCGCTTCTCCCAGATGAGCAGCAGACGACCATGCCCCCTCTGGAATCAATTCAGAAGCTGAGCATTTGGTATTCTAGTTGTTTCTTCTCACCTAATTCGTCAAACTGGCCCTTTGGTTTCTGGGATTGCTTTGCATTTGTGGAAGAATTGTCGATAGTATTATGCGACGATCTTGTCCATTGGCCTGTGAAGGAGCTCTGTGGCTTGAATTCCCTTCGTTGTGTAAGATTTAGTTATTGCAAGAATCTGACCAGTTCATCATCAGAAGAATCCTTATTCCCGTCTGGTCTGGAAAAGTTGTACATAGAATTTTGCAATAACTTATTAGAGATTCCCAAGCTCCCTGCTTCACTGGAGACACTACGCATTAATGAATGCACTTCTTTGGTGTCTCTGCCACCAAATCTTGCAAGACTTGCCAAGTTGAGAGATCTCACATTATTTTCTTGCTCAAGTCTGAGAAATTTGCCTGATGTTATGGATGGCCTCACTGGTCTTCAGGAACTATGTGTTCGGCAGTGCCCTGGGGTAGAGACACTGCCACAGAGTCTTCTTCAGCGACTGCCAAACCTCAGGAAGCTAATGACACTAGGAAGCCACAAGTTAGATAAGCGATGCAGAAGAGGAGGGGAGTACTGGGAGTATGTCTCTAATATTCCATGTCTGAACAGAGACTTCATAGAAGAAAGACCCTGTTAA


Protein sequences

Name Description Sequence
hypothetical protein Os08g0543100 [Oryza sativa (japonica cultivar-group)].

MAESLLLPVVRGVVGKAAGALVQSVTRMCGVDGDRHKLERQLLAVQCKLSDAEAKSETSPAVKRWMKDLKAVAYEADDVLDDFHYEALRRDAQIGDSTTDKVLGYFTPHSPLLFRVAMSKKLNSVLKKINELVEEMNKFGLVERADQATVHVIHPQTHSGLDSLMEIVGRDDDKEMVVNLLLEQRSKRMVEVLSIVGMGGLGKTTLAKMVYNDTRVQQRFELPMWLCVSDDFNVVSLVRSIIELATRGNCTLPDRIELLRSRLHEVVGRKRYLLVLDDVWNEEEHKWEELRPLLHSAGAPGSVVLVTTRSQRVASIMGTVPAHTLSYLNHDDSWELFRKKAFSKEEEQQPEFAEIGNRIVKKCKGLPLALKTMGGLMSSKKRIQEWEAIAGSKSWEDVGTTNEILSILKLSYRHLPLEMKQCFAFCAIFPKDYQMERDKLVQLWIANNFIQEEGMMDLEERGQFVFNELVWRSFFQDVKVESFHVGIKQTYKSITCYMHDLMHDLAKSVTEECVDAQDLNQQKASMKDVRHLMSSAKLQENSELFKHVGPLHTLLSPYWSKSSPLPRNIKRLNLTSLRALHNDKLNVSPKALASITHLRYLDLSHSSKLEHLPDSICMLYSLQALRLNGCLKLQHLPEGMRFMSKLRHLYLIGCHSLKRMPPRIGQLKNLRTLTTFVVDTKDGCGLEELKDLHHLGGRLELFNLKAIQSGSNAREANLHIQENVTELLLHWCHDIFEYSDHDFDLDVVDNKKEIVEFSLPPSRLETLQVWGSGHIEMSSWMKNPAIFLCLKELHMSECWRCKDLPPLWQSVSLESLSLSRLDNLTTLSSGIDMAVPGCNGSLEIFPKLKKMHLHYLPNLEKWMDNEVTSVMFPELKELKIYNCPKLVNIPKAPILRELDIFQCRIALNSLSHLAALSQLNYVGDWSVSKDLQVIPIRSWPSLVTLALASLGNSLLPDEQQTTMPPLESIQKLSIWYSSCFFSPNSSNWPFGFWDCFAFVEELSIVLCDDLVHWPVKELCGLNSLRCVRFSYCKNLTSSSSEESLFPSGLEKLYIEFCNNLLEIPKLPASLETLRINECTSLVSLPPNLARLAKLRDLTLFSCSSLRNLPDVMDGLTGLQELCVRQCPGVETLPQSLLQRLPNLRKLMTLGSHKLDKRCRRGGEYWEYVSNIPCLNRDFIEERPC

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
6-1170 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LLPVVRGVVGKAAGALVQSVTRMCGVDGDRHKLERQLLAVQCKLSDAEAKSETSPAVKRWMKDLKAVAYEADDVLDDFHYEALRRDAQIGDSTTDKVLGYFTPHSPLLFRVAMSKKLNSVLKKINELVEEMNKFGLVERADQATVHVIHPQTHSGLDSLMEIVGRDDDKEMVVNLLLEQRSKRMVEVLSIVGMGGLGKTTLAKMVYNDTRVQQRFELPMWLCVSDDFNVVSLVRSIIELATRGNCTLPDRIELLRSRLHEVVGRKRYLLVLDDVWNEEEHKWEELRPLLHSAGAPGSVVLVTTRSQRVASIMGTVPAHTLSYLNHDDSWELFRKKAFSKEEEQQPEFAEIGNRIVKKCKGLPLALKTMGGLMSSKKRIQEWEAIAGSKSWEDVGTTNEILSILKLSYRHLPLEMKQCFAFCAIFPKDYQMERDKLVQLWIANNFIQEEGMMDLEERGQFVFNELVWRSFFQDVKVESFHVGIKQTYKSITCYMHDLMHDLAKSVTEECVDAQDLNQQKASMKDVRHLMSSAKLQENSELFKHVGPLHTLLSPYWSKSSPLPRNIKRLNLTSLRALHNDKLNVSPKALASITHLRYLDLSHSSKLEHLPDSICMLYSLQALRLNGCLKLQHLPEGMRFMSKLRHLYLIGCHSLKRMPPRIGQLKNLRTLTTFVVDTKDGCGLEELKDLHHLGGRLELFNLKAIQSGSNAREANLHIQENVTELLLHWCHDIFEYSDHDFDLDVVDNKKEIVEFSLPPSRLETLQVWGSGHIEMSSWMKNPAIFLCLKELHMSECWRCKDLPPLWQSVSLESLSLSRLDNLTTLSSGIDMAVPGCNGSLEIFPKLKKMHLHYLPNLEKWMDNEVTSVMFPELKELKIYNCPKLVNIPKAPILRELDIFQCRIALNSLSHLAALSQLNYVGDWSVSKDLQVIPIRSWPSLVTLALASLGNSLLPDEQQTTMPPLESIQKLSIWYSSCFFSPNSSNWPFGFWDCFAFVEELSIVLCDDLVHWPVKELCGLNSLRCVRFSYCKNLTSSSSEESLFPSGLEKLYIEFCNNLLEIPKLPASLETLRINECTSLVSLPPNLARLAKLRDLTLFSCSSLRNLPDVMDGLTGLQELCVRQCPGVETLPQSLLQRLPNLRKLMTLGSHKLDKRCRRGGEYWEYVSN

HMMPanther: PTHR23155:SF182
6-1170 PTHR23155:SF182,OS08G0543500 PROTEIN

LLPVVRGVVGKAAGALVQSVTRMCGVDGDRHKLERQLLAVQCKLSDAEAKSETSPAVKRWMKDLKAVAYEADDVLDDFHYEALRRDAQIGDSTTDKVLGYFTPHSPLLFRVAMSKKLNSVLKKINELVEEMNKFGLVERADQATVHVIHPQTHSGLDSLMEIVGRDDDKEMVVNLLLEQRSKRMVEVLSIVGMGGLGKTTLAKMVYNDTRVQQRFELPMWLCVSDDFNVVSLVRSIIELATRGNCTLPDRIELLRSRLHEVVGRKRYLLVLDDVWNEEEHKWEELRPLLHSAGAPGSVVLVTTRSQRVASIMGTVPAHTLSYLNHDDSWELFRKKAFSKEEEQQPEFAEIGNRIVKKCKGLPLALKTMGGLMSSKKRIQEWEAIAGSKSWEDVGTTNEILSILKLSYRHLPLEMKQCFAFCAIFPKDYQMERDKLVQLWIANNFIQEEGMMDLEERGQFVFNELVWRSFFQDVKVESFHVGIKQTYKSITCYMHDLMHDLAKSVTEECVDAQDLNQQKASMKDVRHLMSSAKLQENSELFKHVGPLHTLLSPYWSKSSPLPRNIKRLNLTSLRALHNDKLNVSPKALASITHLRYLDLSHSSKLEHLPDSICMLYSLQALRLNGCLKLQHLPEGMRFMSKLRHLYLIGCHSLKRMPPRIGQLKNLRTLTTFVVDTKDGCGLEELKDLHHLGGRLELFNLKAIQSGSNAREANLHIQENVTELLLHWCHDIFEYSDHDFDLDVVDNKKEIVEFSLPPSRLETLQVWGSGHIEMSSWMKNPAIFLCLKELHMSECWRCKDLPPLWQSVSLESLSLSRLDNLTTLSSGIDMAVPGCNGSLEIFPKLKKMHLHYLPNLEKWMDNEVTSVMFPELKELKIYNCPKLVNIPKAPILRELDIFQCRIALNSLSHLAALSQLNYVGDWSVSKDLQVIPIRSWPSLVTLALASLGNSLLPDEQQTTMPPLESIQKLSIWYSSCFFSPNSSNWPFGFWDCFAFVEELSIVLCDDLVHWPVKELCGLNSLRCVRFSYCKNLTSSSSEESLFPSGLEKLYIEFCNNLLEIPKLPASLETLRINECTSLVSLPPNLARLAKLRDLTLFSCSSLRNLPDVMDGLTGLQELCVRQCPGVETLPQSLLQRLPNLRKLMTLGSHKLDKRCRRGGEYWEYVSN

superfamily: SSF52540
150-401 SSF52540

VHVIHPQTHSGLDSLMEIVGRDDDKEMVVNLLLEQRSKRMVEVLSIVGMGGLGKTTLAKMVYNDTRVQQRFELPMWLCVSDDFNVVSLVRSIIELATRGNCTLPDRIELLRSRLHEVVGRKRYLLVLDDVWNEEEHKWEELRPLLHSAGAPGSVVLVTTRSQRVASIMGTVPAHTLSYLNHDDSWELFRKKAFSKEEEQQPEFAEIGNRIVKKCKGLPLALKTMGGLMSSKKRIQEWEAIAGSKSWEDVGTT

Gene3D: G3DSA:3.40.50.300
168-318 G3DSA:3.40.50.300

VGRDDDKEMVVNLLLEQRSKRMVEVLSIVGMGGLGKTTLAKMVYNDTRVQQRFELPMWLCVSDDFNVVSLVRSIIELATRGNCTLPDRIELLRSRLHEVVGRKRYLLVLDDVWNEEEHKWEELRPLLHSAGAPGSVVLVTTRSQRVASIMG

HMMPfam: PF00931
IPR002182
171-452 NB-ARC,NBS
NB-ARC

DDDKEMVVNLLLEQRSKRMVEVLSIVGMGGLGKTTLAKMVYNDTRVQQRFELPMWLCVSDDFNVVSLVRSIIELATRGNCTLPDRIELLRSRLHEVVGRKRYLLVLDDVWNEEEHKWEELRPLLHSAGAPGSVVLVTTRSQRVASIMGTVPAHTLSYLNHDDSWELFRKKAFSKEEEQQPEFAEIGNRIVKKCKGLPLALKTMGGLMSSKKRIQEWEAIAGSKSWEDVGTTNEILSILKLSYRHLPLEMKQCFAFCAIFPKDYQMERDKLVQLWIANNFIQE

FPrintScan: PR00364
IPR000767
192-207 DISEASERSIST
Disease resistance protein

VLSIVGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
266-280 DISEASERSIST
Disease resistance protein

VVGRKRYLLVLDDVW

FPrintScan: PR00364
IPR000767
363-377 DISEASERSIST
Disease resistance protein

CKGLPLALKTMGGLM

superfamily: SSF52058
497-951 SSF52058,LRR

YMHDLMHDLAKSVTEECVDAQDLNQQKASMKDVRHLMSSAKLQENSELFKHVGPLHTLLSPYWSKSSPLPRNIKRLNLTSLRALHNDKLNVSPKALASITHLRYLDLSHSSKLEHLPDSICMLYSLQALRLNGCLKLQHLPEGMRFMSKLRHLYLIGCHSLKRMPPRIGQLKNLRTLTTFVVDTKDGCGLEELKDLHHLGGRLELFNLKAIQSGSNAREANLHIQENVTELLLHWCHDIFEYSDHDFDLDVVDNKKEIVEFSLPPSRLETLQVWGSGHIEMSSWMKNPAIFLCLKELHMSECWRCKDLPPLWQSVSLESLSLSRLDNLTTLSSGIDMAVPGCNGSLEIFPKLKKMHLHYLPNLEKWMDNEVTSVMFPELKELKIYNCPKLVNIPKAPILRELDIFQCRIALNSLSHLAALSQLNYVGDWSVSKDLQVIPIRSWPSLVTLALASLG

Gene3D: G3DSA:3.80.10.10
563-674 G3DSA:3.80.10.10

SPLPRNIKRLNLTSLRALHNDKLNVSPKALASITHLRYLDLSHSSKLEHLPDSICMLYSLQALRLNGCLKLQHLPEGMRFMSKLRHLYLIGCHSLKRMPPRIGQLKNLRTLT

FPrintScan: PR00364
IPR000767
593-609 DISEASERSIST
Disease resistance protein

ASITHLRYLDLSHSSKL

HMMPfam: PF00560
IPR001611
597-616 LRR_1
Leucine-rich repeat

HLRYLDLSHSSKLEHLPDSI

Gene3D: G3DSA:3.80.10.10
762-969 G3DSA:3.80.10.10

SRLETLQVWGSGHIEMSSWMKNPAIFLCLKELHMSECWRCKDLPPLWQSVSLESLSLSRLDNLTTLSSGIDMAVPGCNGSLEIFPKLKKMHLHYLPNLEKWMDNEVTSVMFPELKELKIYNCPKLVNIPKAPILRELDIFQCRIALNSLSHLAALSQLNYVGDWSVSKDLQVIPIRSWPSLVTLALASLGNSLLPDEQQTTMPPLESI

superfamily: SSF52047
929-1146 SSF52047,LRR

KDLQVIPIRSWPSLVTLALASLGNSLLPDEQQTTMPPLESIQKLSIWYSSCFFSPNSSNWPFGFWDCFAFVEELSIVLCDDLVHWPVKELCGLNSLRCVRFSYCKNLTSSSSEESLFPSGLEKLYIEFCNNLLEIPKLPASLETLRINECTSLVSLPPNLARLAKLRDLTLFSCSSLRNLPDVMDGLTGLQELCVRQCPGVETLPQSLLQRLPNLRKL

Gene3D: G3DSA:3.80.10.10
1017-1146 G3DSA:3.80.10.10

ELCGLNSLRCVRFSYCKNLTSSSSEESLFPSGLEKLYIEFCNNLLEIPKLPASLETLRINECTSLVSLPPNLARLAKLRDLTLFSCSSLRNLPDVMDGLTGLQELCVRQCPGVETLPQSLLQRLPNLRKL


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox