PRGDB00049961 (Os08g0296600)

From PRG Wiki
Revision as of 17:09, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Os08g0296600
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115475759 (NM_001068011)
Gene Class NL
Domain Type LRR, NBS, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os08g0296600 (Os08g0296600) mRNA, complete cds.

DNA Sequence

ATGGATATCGCTCTTGCTTCTGCGGCGGCGACATGGCTGATCAACAAGCTCCTGGACCGGCTGAGCGACTATGCCATCAAGAAGCTGCTGGGCTCGGAGGGCCTGGACGCGGAGGCCAGCTCCCTCAGGGATGCGCTGCGGCGAGCCACGCTCGTCCTCGGCGCCGTGCCCGCCGGTGCCGCCGCAGGGGTCAGGATTGGGAACGACCAGCTACTTCCGCAGATCGACCTGGTTCAGCGGCTAGCCACCGATTTGGCCAGGCACCTCGACGAGCTCGAGTACTACGACGTCAAGAAAAAGGTAAAGAAGAACCAGAAGAGCAGCAATCCATTATCCAAAATGAATTTACCCCTTACTCAAGCTGGGCAATCAAAGCCGAAGTACAATAGAACAGACATAAAACAGATTAGAGATACTGTGGGATATTTGCATAGCATTTGTGATGATGTTCACAAGGCTCTCTTGCTAGATAAACTTGATGCAATTAAACAAGCTGCTCAAGATGCAAGTACAGACAAACGTGAGACTGTGGATAACTTCACTGAAAATCCTAGAAATAAGGTGTTCCCAAGGGAAGAAATGAAAGATATTATAGAACTAATTAATAGTGCTGCATCGAGTGATCAAGAACTTTTAGTTGTTCCAATAGTTGGTGCTGGTGGTGTTGGGAAGACAACACTTGCTCGATTGGTGTACCATGACCCAGAAGTAAAAGATAAATTTGACATCATGCTCTGGATCTACGTATCTGCTAACTTTGATGAAGTTAAGCTTACACAAGGGATTCTGGAACAAATACCTGAATGTGAGTTCAAAAGCGCCAAGAATCTCACTGTGCTTCAGCGTGGTATCAACAAATATTTGACCAAAAGATTTCTGCTTGTTCTGGATGACATGTGGGAAGAGAGTGAGGGTCGTTGGGACAAGTTATTGGCCCCACTTAGATCCGCACAGGCTAAGGGTAACGTACTCTTGGTAACTACTCGGAAGTTATCGGTGGCTAGGATAACTAGCAACACAGAAGCACACATTGACTTGGATGGTATGAAAAAAGATGACTTCTGGTTATTCTTCAAAAGATGCATATTTGGTGATGAAAACTATCAAGGCCAAAGGAAGCTACAGAATATTGCTAAGAAAATAGCCACCAGACTGAATGGCAATCCATTGGCAGCAAAAAGTGTTGGTACACTTTTGAGAAGAAATATTAATGAGGATTACTGGACAAGAATTCTAGATAGCAATGAATGGAAGTTACAAGAAAGTATTGATGACATTATACCTGCACTAAAGCTCAGTTACAATCAGCTTCCCTATCGTCTTCAGCTACTCTTCAGTTACTGTGCTATGTTTCCAAAGGGTTACAATTTTGACAAAGGACAGTTGATATGTACATGGATTGCTCTGGGATTTGTCATGAATGAGAGAAAGAAATTGGAGGATGAAGGAAGTGACTGTTTTGATGATTTGGTAGACCGAAGCTTTTTCCAGAAATATGGAGTGTCACAGTATTATACTGTGCATGATTTAATGCATGATGTTGCACAAGAAGTCTCCATTAACAAATGCCTTATTATTGATGGGTCAGATCTTCGAACAGTTCCGTCGTCCATTTGTCACCTTAGCATCTGGACTGAGCCGGTGTACAATGAGCAAAGCATAGAACGGAATGATAACTTTGAAGAGAAGTTAGATGCAGTCCAGGATAATGTCTTGGGAAGCTTGGAGTGTTTAATTCTTGCAGGTGTATATGATGAGAACTACTCTGCTAAGTTTGTGAAGACTCTTGAGCGAGTACGTTATGTCCGGATGCTCCAGTTAACAGCAATGCCATTCAATTCTGACATTCTACTATCCAGTATAAAGAAGTTAATCCATCTTCGCTACTTAGAACTGAGGTGTACGTCGGATAAGCCCAAATCTTTGCCTGAGGCTATATGTAAGCTCTACCACCTACAAGTACTAGATGTTCAACATTGGAGTGGTCTAAATGATTTGCCAAAGGATATGAGTAATCTTGTGAACCTACGCCATCTGTTTGTTCCGGGGTCAGGATCATTGCACTCCAAGATATCCAGAGTTGGGGAACTTAAGTTTCTACAAGAACTGAAAGAATTTCAGGTTCAAGAAGCCGATGGCTTTGAGATTTCACAACTCGGGAACATAAATGAAATCAGAGGATCACTTAGTATCCTTGGCCTTGAGACTGTCAAAAAGAAGGGAGATGCAACTCGTGCAAGGCTTAAAGACAAAAAACACCTGAGGACACTTTCACTAACATGGGGGAGTGCAAGCGGAAGTACTACTACCGTCCAGAAAGAAGTGATGGAGGGTCTTAAACCACATGAAAATCTTTCCCATCTTCTTGTCTACAATTATTCTGGTGCTACTCCATCATGGTTATTAGGAGATAGTTTCTCACTTGGCAATTTAGAAAGCCTCCATCTCCAGGATTGTGCAGCAGTGAAGATCCTTCCACCATTTGAGGAGATGCCATTCCTGAAGAAGCTGTCCTTGGTTTGTATGCCCTGTCTGAAAAGTATCAGGATTGACTTCAACTCTGCCGATGAGGAGGATGAACTTGAGTTAAGCGAAATTGAAATATCCAAATGTTTAGCTTTAACATCCATAAGACTACATTCCTGCAAGGCGTTGACTATGTTAAGCATCAATGATTGTGAGGCACTAGGTTCCTTAGAGGGCTTGTCATTTTCTGAAAAACTGAAGCAGTGTGTTGTCCAAGGATGCCCAAAACTTCCGTCAGGTTTCATCGCAAACTGA


Protein sequences

Name Description Sequence
hypothetical protein Os08g0296600 [Oryza sativa (japonica cultivar-group)].

MDIALASAAATWLINKLLDRLSDYAIKKLLGSEGLDAEASSLRDALRRATLVLGAVPAGAAAGVRIGNDQLLPQIDLVQRLATDLARHLDELEYYDVKKKVKKNQKSSNPLSKMNLPLTQAGQSKPKYNRTDIKQIRDTVGYLHSICDDVHKALLLDKLDAIKQAAQDASTDKRETVDNFTENPRNKVFPREEMKDIIELINSAASSDQELLVVPIVGAGGVGKTTLARLVYHDPEVKDKFDIMLWIYVSANFDEVKLTQGILEQIPECEFKSAKNLTVLQRGINKYLTKRFLLVLDDMWEESEGRWDKLLAPLRSAQAKGNVLLVTTRKLSVARITSNTEAHIDLDGMKKDDFWLFFKRCIFGDENYQGQRKLQNIAKKIATRLNGNPLAAKSVGTLLRRNINEDYWTRILDSNEWKLQESIDDIIPALKLSYNQLPYRLQLLFSYCAMFPKGYNFDKGQLICTWIALGFVMNERKKLEDEGSDCFDDLVDRSFFQKYGVSQYYTVHDLMHDVAQEVSINKCLIIDGSDLRTVPSSICHLSIWTEPVYNEQSIERNDNFEEKLDAVQDNVLGSLECLILAGVYDENYSAKFVKTLERVRYVRMLQLTAMPFNSDILLSSIKKLIHLRYLELRCTSDKPKSLPEAICKLYHLQVLDVQHWSGLNDLPKDMSNLVNLRHLFVPGSGSLHSKISRVGELKFLQELKEFQVQEADGFEISQLGNINEIRGSLSILGLETVKKKGDATRARLKDKKHLRTLSLTWGSASGSTTTVQKEVMEGLKPHENLSHLLVYNYSGATPSWLLGDSFSLGNLESLHLQDCAAVKILPPFEEMPFLKKLSLVCMPCLKSIRIDFNSADEEDELELSEIEISKCLALTSIRLHSCKALTMLSINDCEALGSLEGLSFSEKLKQCVVQGCPKLPSGFIAN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF28
39-921 PTHR11017:SF28

ASSLRDALRRATLVLGAVPAGAAAGVRIGNDQLLPQIDLVQRLATDLARHLDELEYYDVKKKVKKNQKSSNPLSKMNLPLTQAGQSKPKYNRTDIKQIRDTVGYLHSICDDVHKALLLDKLDAIKQAAQDASTDKRETVDNFTENPRNKVFPREEMKDIIELINSAASSDQELLVVPIVGAGGVGKTTLARLVYHDPEVKDKFDIMLWIYVSANFDEVKLTQGILEQIPECEFKSAKNLTVLQRGINKYLTKRFLLVLDDMWEESEGRWDKLLAPLRSAQAKGNVLLVTTRKLSVARITSNTEAHIDLDGMKKDDFWLFFKRCIFGDENYQGQRKLQNIAKKIATRLNGNPLAAKSVGTLLRRNINEDYWTRILDSNEWKLQESIDDIIPALKLSYNQLPYRLQLLFSYCAMFPKGYNFDKGQLICTWIALGFVMNERKKLEDEGSDCFDDLVDRSFFQKYGVSQYYTVHDLMHDVAQEVSINKCLIIDGSDLRTVPSSICHLSIWTEPVYNEQSIERNDNFEEKLDAVQDNVLGSLECLILAGVYDENYSAKFVKTLERVRYVRMLQLTAMPFNSDILLSSIKKLIHLRYLELRCTSDKPKSLPEAICKLYHLQVLDVQHWSGLNDLPKDMSNLVNLRHLFVPGSGSLHSKISRVGELKFLQELKEFQVQEADGFEISQLGNINEIRGSLSILGLETVKKKGDATRARLKDKKHLRTLSLTWGSASGSTTTVQKEVMEGLKPHENLSHLLVYNYSGATPSWLLGDSFSLGNLESLHLQDCAAVKILPPFEEMPFLKKLSLVCMPCLKSIRIDFNSADEEDELELSEIEISKCLALTSIRLHSCKALTMLSINDCEALGSLEGLSFSEKLKQCVVQGCPKLPS

HMMPanther: PTHR11017
39-921 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ASSLRDALRRATLVLGAVPAGAAAGVRIGNDQLLPQIDLVQRLATDLARHLDELEYYDVKKKVKKNQKSSNPLSKMNLPLTQAGQSKPKYNRTDIKQIRDTVGYLHSICDDVHKALLLDKLDAIKQAAQDASTDKRETVDNFTENPRNKVFPREEMKDIIELINSAASSDQELLVVPIVGAGGVGKTTLARLVYHDPEVKDKFDIMLWIYVSANFDEVKLTQGILEQIPECEFKSAKNLTVLQRGINKYLTKRFLLVLDDMWEESEGRWDKLLAPLRSAQAKGNVLLVTTRKLSVARITSNTEAHIDLDGMKKDDFWLFFKRCIFGDENYQGQRKLQNIAKKIATRLNGNPLAAKSVGTLLRRNINEDYWTRILDSNEWKLQESIDDIIPALKLSYNQLPYRLQLLFSYCAMFPKGYNFDKGQLICTWIALGFVMNERKKLEDEGSDCFDDLVDRSFFQKYGVSQYYTVHDLMHDVAQEVSINKCLIIDGSDLRTVPSSICHLSIWTEPVYNEQSIERNDNFEEKLDAVQDNVLGSLECLILAGVYDENYSAKFVKTLERVRYVRMLQLTAMPFNSDILLSSIKKLIHLRYLELRCTSDKPKSLPEAICKLYHLQVLDVQHWSGLNDLPKDMSNLVNLRHLFVPGSGSLHSKISRVGELKFLQELKEFQVQEADGFEISQLGNINEIRGSLSILGLETVKKKGDATRARLKDKKHLRTLSLTWGSASGSTTTVQKEVMEGLKPHENLSHLLVYNYSGATPSWLLGDSFSLGNLESLHLQDCAAVKILPPFEEMPFLKKLSLVCMPCLKSIRIDFNSADEEDELELSEIEISKCLALTSIRLHSCKALTMLSINDCEALGSLEGLSFSEKLKQCVVQGCPKLPS

Gene3D: G3DSA:3.40.50.300
159-330 G3DSA:3.40.50.300

LDAIKQAAQDASTDKRETVDNFTENPRNKVFPREEMKDIIELINSAASSDQELLVVPIVGAGGVGKTTLARLVYHDPEVKDKFDIMLWIYVSANFDEVKLTQGILEQIPECEFKSAKNLTVLQRGINKYLTKRFLLVLDDMWEESEGRWDKLLAPLRSAQAKGNVLLVTTRK

superfamily: SSF52540
170-423 SSF52540

STDKRETVDNFTENPRNKVFPREEMKDIIELINSAASSDQELLVVPIVGAGGVGKTTLARLVYHDPEVKDKFDIMLWIYVSANFDEVKLTQGILEQIPECEFKSAKNLTVLQRGINKYLTKRFLLVLDDMWEESEGRWDKLLAPLRSAQAKGNVLLVTTRKLSVARITSNTEAHIDLDGMKKDDFWLFFKRCIFGDENYQGQRKLQNIAKKIATRLNGNPLAAKSVGTLLRRNINEDYWTRILDSNEWKLQESI

HMMPfam: PF00931
IPR002182
197-475 NB-ARC,NBS
NB-ARC

IIELINSAASSDQELLVVPIVGAGGVGKTTLARLVYHDPEVKDKFDIMLWIYVSANFDEVKLTQGILEQIPECEFKSAKNLTVLQRGINKYLTKRFLLVLDDMWEESEGRWDKLLAPLRSAQAKGNVLLVTTRKLSVARITSNTEAHIDLDGMKKDDFWLFFKRCIFGDENYQGQRKLQNIAKKIATRLNGNPLAAKSVGTLLRRNINEDYWTRILDSNEWKLQESIDDIIPALKLSYNQLPYRLQLLFSYCAMFPKGYNFDKGQLICTWIALGFVMNE

FPrintScan: PR00364
IPR000767
213-228 DISEASERSIST
Disease resistance protein

VVPIVGAGGVGKTTLA

FPrintScan: PR00364
IPR000767
286-300 DISEASERSIST
Disease resistance protein

KYLTKRFLLVLDDMW

FPrintScan: PR00364
IPR000767
385-399 DISEASERSIST
Disease resistance protein

LNGNPLAAKSVGTLL

superfamily: SSF52058
506-919 SSF52058,LRR

TVHDLMHDVAQEVSINKCLIIDGSDLRTVPSSICHLSIWTEPVYNEQSIERNDNFEEKLDAVQDNVLGSLECLILAGVYDENYSAKFVKTLERVRYVRMLQLTAMPFNSDILLSSIKKLIHLRYLELRCTSDKPKSLPEAICKLYHLQVLDVQHWSGLNDLPKDMSNLVNLRHLFVPGSGSLHSKISRVGELKFLQELKEFQVQEADGFEISQLGNINEIRGSLSILGLETVKKKGDATRARLKDKKHLRTLSLTWGSASGSTTTVQKEVMEGLKPHENLSHLLVYNYSGATPSWLLGDSFSLGNLESLHLQDCAAVKILPPFEEMPFLKKLSLVCMPCLKSIRIDFNSADEEDELELSEIEISKCLALTSIRLHSCKALTMLSINDCEALGSLEGLSFSEKLKQCVVQGCPKL

Gene3D: G3DSA:3.80.10.10
553-784 G3DSA:3.80.10.10

SIERNDNFEEKLDAVQDNVLGSLECLILAGVYDENYSAKFVKTLERVRYVRMLQLTAMPFNSDILLSSIKKLIHLRYLELRCTSDKPKSLPEAICKLYHLQVLDVQHWSGLNDLPKDMSNLVNLRHLFVPGSGSLHSKISRVGELKFLQELKEFQVQEADGFEISQLGNINEIRGSLSILGLETVKKKGDATRARLKDKKHLRTLSLTWGSASGSTTTVQKEVMEGLKPHEN

Gene3D: G3DSA:3.80.10.10
785-905 G3DSA:3.80.10.10

LSHLLVYNYSGATPSWLLGDSFSLGNLESLHLQDCAAVKILPPFEEMPFLKKLSLVCMPCLKSIRIDFNSADEEDELELSEIEISKCLALTSIRLHSCKALTMLSINDCEALGSLEGLSFS

FPrintScan: PR00364
IPR000767
806-822 DISEASERSIST
Disease resistance protein

FSLGNLESLHLQDCAAV


List of References

Hajime Ohyanagi, Tsuyoshi Tanaka, Hiroaki Sakai, Yasumasa Shigemoto, Kaori Yamaguchi, Takuya Habara, Yasuyuki Fujii, Baltazar A Antonio, Yoshiaki Nagamura, Tadashi Imanishi, Kazuho Ikeo, Takeshi Itoh, Takashi Gojobori, Takuji Sasaki
The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information.
Nucleic Acids Res.: 2006, 34(Database issue);D741-4
PubMed:16381971 WorldCat.org DOI (I p)


The map-based sequence of the rice genome.
Nature: 2005, 436(7052);793-800
PubMed:16100779 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox