PRGDB00050009 (Os05g0305600)

From PRG Wiki
Revision as of 17:11, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Os05g0305600
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115463098 (NM_001061684)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os05g0305600 (Os05g0305600) mRNA, complete cds.

DNA Sequence

ATGTTCCGTCGCAAGATGGCCCGTAAGATCAAGGATATCAAGGTGAAATATAATGAGATTGTGCGACAAAGAAGGGATGCCAATACTATACGCAGTAGTTTACAAGTGGATCAACCTATTCCTAGCAGTAACATGATAATCGGGGAGTTGTCCTTGTTGAGTAATGTTGAAGAATCAAAAATACCTATCAGGGACCAGGAGATGGATACAATTGTATCTATGCTTGTAGACTCTAATGAGGGAGAGAATTGTTGGATAGTTTCCGTTGTTGGGCTAGGCGGGTCCGGCAAAACTACTCTGGCCAAACACATTTGCCATGTCAACAAGATAAAGGAGCTATTTAAAGAGAGAATTTTCTGGGTCCATGTGTCTAGAGAGTTTGATGTGCAAAAGCTCATCGGCAAGCTATATGAAACTATCGTTGGCAGAAAGTCAGATTGTCAACCCCAACAGCAGATGGTCCGTGAAATTTCCAAGCAGTTATGTTGTAATAAGTTCCTTCTTGTTCTTGATGATGCTTGGCATACGGATGGGTATGAGTGGGGACAATTCATGGTGCATCTACAGGATAGGTCAATTGGAAGTAGGATTTTGCTAACTACTCGTGATCGAAAGGTTGCAGAAGTAGTCAAATCCAAACAAATACATGAGTTGGTGTTCTTAACAGAGTCTGAGAGTTGGAGCTTGTTCCTAAAGTGTTCTGGGTGGGTGGAGGATGATTTGGGATCAGAATTTATACAGCTTGGAAAAGAGATTCTGAAGAAATGTGGTGGGGTACCTCTAGCAATCAGAACTATTGCAGGTGTCCTCTGTGAAAAGAGGGAGATAAGTACTTGGAGAGCCATAAGAGGGAGTGACTTATGGAACGTTGGGAGTGTAAACGACAGGGTGTTTGCATCCTTAAAGTTGAGCTACATTCACCTGGCAGATAAACTAAAGCAGTGCTTTACATTCTGCTCCATATTTCCAAAAGGCTATGTGATCAATAAAGACAGATTGGTTGCACAATGGATAGCCCATGGATTCATCACGCCGATGAAGGAAGAGCAGCCAAAAGATATTGCAAGTGAATATTTTGATTCTCTTGTGAAAGCTGGCTTCTTTCTTCAAGATACGATTGAAGAGTTTGGTTACTTGCACAAGATGCATGACCTGATTCACGATCTTGCTCAATATTGTGAAAAGAATGAAGTGGTGACATCTCGACCGAACAGTATGTCTACATATCAGACACACAAATGCAGATATTTATCTTTGACATCAGGAAATGAGAAGGTCAAGAGGGGCTTACTTGACAAGGTTCATGCTTTATATATGTCTGATGGCAACCTATCATTCGATAAACCAGTTAAGAAGAGTTGCTATATCCGCAGTGTAATTTTGGACAATGAAAACTGTACCACTTTTCCACCAGTCTTGTTGAAGTTTGAATTTCTTGGATATCTTGAAATCCATGGAGTTGATTGCAAGAAACTTCCTGAAGCAATCTCCGGCTGTTGGAACTTGCAGTCACTTCATTTTATTCGGTGCAGCGGATTTGTGATGTTACCTGAGTCTGTTGGCAAACTTAAGAAGCTAAGAACTTTAGAGCTAAATTATGTTATTGATCTTGAGAGTTTGCCGCAGTCCATTGGTGATTGTCAAGGTCTTCAATCCTTGCAACTACATAGCTGTAACAAACTTCAAGGCATGCCGACTTCGATAGGCAGAATTGAGAACCTAAGGGTGCTTCATATTACGTCGTGTCCATGTATGCAAAAACTACCGTCAGAGCCCTGTGGGGAGTCCAACAACCTGGAGATAATCAACTTATCTAATTGCCACAACTTCCATGGCCTGCCAAGCACATTTGCCTGCAAAGCATTGCGTACTCTTAATCTTTACAATACCAAGATTACCATGTTACCTCAATGGGTAACTTCAATCGATACTCTAGAATGTCTAGACCTTGGATATTGCCACGAGCTCATGGAATTTCCTAAAGGTATAGCAAACTTGAGAAGGCTTGCAGTTTTGAACTTAGAGGGTTGCAGTAAACTACGTTGCATGCCATCAGGTTTCAGACAACTGACTCGTTTAACAAAGATGGGTTTGTTTGTTGTTGGATGTGATGGTGATAATGCAAGGATCTCAGAGCTTGAAACCCTTGATATGATAAGTGGTAAGATGAAAATTATCAACCTTAAATATACGCTGGATCCAACTGATGCAGATAAGGCCAGCTTGAAGAGGAAGAACAACATAAAGTATCTGGAGTTGGACTGGTCTCGAGGTGAAACTGAAAAGGAGTTAGTAACAGATATGGTCATGGAGCAAGACCTGGCTGTGCTGAACGCTCTTGAACCACCATCCCGAATTGAGGAAATATTAATATATTATTATGGAGGTCCCTGTTTGCCATGGTGGATGAAGAAGCAAACTGATTCTTCTTGCTGGGAAAGCACAATGTTAAAGCAAACCAATCCATGTCAGCTTATTTATCTAACTAGAATGACACTACATGAAATTCCAAACTTGAAGCATATGCAAGGACTTGTTGAGTTGCCTTTGCTGAATTACCTTGAACTATTTGGATTGCCTAATTTGGAGGACATGTGGACCACGACAGGAGGTGCAGAAATCAGGGGTGATGAATTGCAGGCAAAATACTGTTTCCCTGCCCTGTCCACCTTATGGATAAGGGGCTGTCCGAGATTGAATGTGGTGCCCTACTTCCCATCATCTTTGGAGAGACTTTTTTTAAGAGAAAGCAATGATCAGCTGCTATCTTCAGGCAGCTTCTCCCATCTCCTTCCTCCACTTGCCCATGAATCTTCTCCTTGCAGCAATGCGCACTCAGCGGTGCCCCGACTGAAGGAACTAACTATAATTAAAATGACAGGATCATCGTGTGGTTGGGATTTCCTGCAGTACCTTGATGCACTAGAGTACTTCAATATTTTTGGCAGCAATGACCTAACACAATTACCTGAGAGCATGCGAAGCCTCACCTCCCTCCACAAGCTAATCATCCACGACTGTCCCACCTTTGGCATGCTGCCAGAATGGCTTGGAGAACTGTGTTCTTTACAGTCCCTGTTTATCAAGGGGACCCCAATGATGGACAGTCTCCCTCAATCGATTGGCTGCCTTACGTCCCTCACGCACTTGACTATTGCATGCGATAATTTGAAACAGCTGCCTGAGACGTTTCACCACCTCACCTCCCTTCGAGAACTCGACTTGGCAGGATGTGGTGCCCTGACTGCACTGCCAGAAAACATCGGGAAACTCTCTGCACTTGAAGCACTATATGTCGGACCGTGCTCTGCCATTCAATGCCTGCCCGAGTCCATAAAACACCTTACTAATCTCCGGCGATTGAACATTTCTGGTTGCCCTAATTTGGTCAAGCGTTGCGAGCAAGAAGTGGGGGAAGACTGGCAGCTTGTCTCTCATATTCCTAATTTAATAAGTGACTAA


Protein sequences

Name Description Sequence
hypothetical protein Os05g0305600 [Oryza sativa (japonica cultivar-group)].

MFRRKMARKIKDIKVKYNEIVRQRRDANTIRSSLQVDQPIPSSNMIIGELSLLSNVEESKIPIRDQEMDTIVSMLVDSNEGENCWIVSVVGLGGSGKTTLAKHICHVNKIKELFKERIFWVHVSREFDVQKLIGKLYETIVGRKSDCQPQQQMVREISKQLCCNKFLLVLDDAWHTDGYEWGQFMVHLQDRSIGSRILLTTRDRKVAEVVKSKQIHELVFLTESESWSLFLKCSGWVEDDLGSEFIQLGKEILKKCGGVPLAIRTIAGVLCEKREISTWRAIRGSDLWNVGSVNDRVFASLKLSYIHLADKLKQCFTFCSIFPKGYVINKDRLVAQWIAHGFITPMKEEQPKDIASEYFDSLVKAGFFLQDTIEEFGYLHKMHDLIHDLAQYCEKNEVVTSRPNSMSTYQTHKCRYLSLTSGNEKVKRGLLDKVHALYMSDGNLSFDKPVKKSCYIRSVILDNENCTTFPPVLLKFEFLGYLEIHGVDCKKLPEAISGCWNLQSLHFIRCSGFVMLPESVGKLKKLRTLELNYVIDLESLPQSIGDCQGLQSLQLHSCNKLQGMPTSIGRIENLRVLHITSCPCMQKLPSEPCGESNNLEIINLSNCHNFHGLPSTFACKALRTLNLYNTKITMLPQWVTSIDTLECLDLGYCHELMEFPKGIANLRRLAVLNLEGCSKLRCMPSGFRQLTRLTKMGLFVVGCDGDNARISELETLDMISGKMKIINLKYTLDPTDADKASLKRKNNIKYLELDWSRGETEKELVTDMVMEQDLAVLNALEPPSRIEEILIYYYGGPCLPWWMKKQTDSSCWESTMLKQTNPCQLIYLTRMTLHEIPNLKHMQGLVELPLLNYLELFGLPNLEDMWTTTGGAEIRGDELQAKYCFPALSTLWIRGCPRLNVVPYFPSSLERLFLRESNDQLLSSGSFSHLLPPLAHESSPCSNAHSAVPRLKELTIIKMTGSSCGWDFLQYLDALEYFNIFGSNDLTQLPESMRSLTSLHKLIIHDCPTFGMLPEWLGELCSLQSLFIKGTPMMDSLPQSIGCLTSLTHLTIACDNLKQLPETFHHLTSLRELDLAGCGALTALPENIGKLSALEALYVGPCSAIQCLPESIKHLTNLRRLNISGCPNLVKRCEQEVGEDWQLVSHIPNLISD

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-1151 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MFRRKMARKIKDIKVKYNEIVRQRRDANTIRSSLQVDQPIPSSNMIIGELSLLSNVEESKIPIRDQEMDTIVSMLVDSNEGENCWIVSVVGLGGSGKTTLAKHICHVNKIKELFKERIFWVHVSREFDVQKLIGKLYETIVGRKSDCQPQQQMVREISKQLCCNKFLLVLDDAWHTDGYEWGQFMVHLQDRSIGSRILLTTRDRKVAEVVKSKQIHELVFLTESESWSLFLKCSGWVEDDLGSEFIQLGKEILKKCGGVPLAIRTIAGVLCEKREISTWRAIRGSDLWNVGSVNDRVFASLKLSYIHLADKLKQCFTFCSIFPKGYVINKDRLVAQWIAHGFITPMKEEQPKDIASEYFDSLVKAGFFLQDTIEEFGYLHKMHDLIHDLAQYCEKNEVVTSRPNSMSTYQTHKCRYLSLTSGNEKVKRGLLDKVHALYMSDGNLSFDKPVKKSCYIRSVILDNENCTTFPPVLLKFEFLGYLEIHGVDCKKLPEAISGCWNLQSLHFIRCSGFVMLPESVGKLKKLRTLELNYVIDLESLPQSIGDCQGLQSLQLHSCNKLQGMPTSIGRIENLRVLHITSCPCMQKLPSEPCGESNNLEIINLSNCHNFHGLPSTFACKALRTLNLYNTKITMLPQWVTSIDTLECLDLGYCHELMEFPKGIANLRRLAVLNLEGCSKLRCMPSGFRQLTRLTKMGLFVVGCDGDNARISELETLDMISGKMKIINLKYTLDPTDADKASLKRKNNIKYLELDWSRGETEKELVTDMVMEQDLAVLNALEPPSRIEEILIYYYGGPCLPWWMKKQTDSSCWESTMLKQTNPCQLIYLTRMTLHEIPNLKHMQGLVELPLLNYLELFGLPNLEDMWTTTGGAEIRGDELQAKYCFPALSTLWIRGCPRLNVVPYFPSSLERLFLRESNDQLLSSGSFSHLLPPLAHESSPCSNAHSAVPRLKELTIIKMTGSSCGWDFLQYLDALEYFNIFGSNDLTQLPESMRSLTSLHKLIIHDCPTFGMLPEWLGELCSLQSLFIKGTPMMDSLPQSIGCLTSLTHLTIACDNLKQLPETFHHLTSLRELDLAGCGALTALPENIGKLSALEALYVGPCSAIQCLPESIKHLTNLRRLNISGCPNLVKRCEQEVGEDWQLVSHIPNLI

HMMPanther: PTHR23155:SF146
1-1151 PTHR23155:SF146,OS05G0305600 PROTEIN

MFRRKMARKIKDIKVKYNEIVRQRRDANTIRSSLQVDQPIPSSNMIIGELSLLSNVEESKIPIRDQEMDTIVSMLVDSNEGENCWIVSVVGLGGSGKTTLAKHICHVNKIKELFKERIFWVHVSREFDVQKLIGKLYETIVGRKSDCQPQQQMVREISKQLCCNKFLLVLDDAWHTDGYEWGQFMVHLQDRSIGSRILLTTRDRKVAEVVKSKQIHELVFLTESESWSLFLKCSGWVEDDLGSEFIQLGKEILKKCGGVPLAIRTIAGVLCEKREISTWRAIRGSDLWNVGSVNDRVFASLKLSYIHLADKLKQCFTFCSIFPKGYVINKDRLVAQWIAHGFITPMKEEQPKDIASEYFDSLVKAGFFLQDTIEEFGYLHKMHDLIHDLAQYCEKNEVVTSRPNSMSTYQTHKCRYLSLTSGNEKVKRGLLDKVHALYMSDGNLSFDKPVKKSCYIRSVILDNENCTTFPPVLLKFEFLGYLEIHGVDCKKLPEAISGCWNLQSLHFIRCSGFVMLPESVGKLKKLRTLELNYVIDLESLPQSIGDCQGLQSLQLHSCNKLQGMPTSIGRIENLRVLHITSCPCMQKLPSEPCGESNNLEIINLSNCHNFHGLPSTFACKALRTLNLYNTKITMLPQWVTSIDTLECLDLGYCHELMEFPKGIANLRRLAVLNLEGCSKLRCMPSGFRQLTRLTKMGLFVVGCDGDNARISELETLDMISGKMKIINLKYTLDPTDADKASLKRKNNIKYLELDWSRGETEKELVTDMVMEQDLAVLNALEPPSRIEEILIYYYGGPCLPWWMKKQTDSSCWESTMLKQTNPCQLIYLTRMTLHEIPNLKHMQGLVELPLLNYLELFGLPNLEDMWTTTGGAEIRGDELQAKYCFPALSTLWIRGCPRLNVVPYFPSSLERLFLRESNDQLLSSGSFSHLLPPLAHESSPCSNAHSAVPRLKELTIIKMTGSSCGWDFLQYLDALEYFNIFGSNDLTQLPESMRSLTSLHKLIIHDCPTFGMLPEWLGELCSLQSLFIKGTPMMDSLPQSIGCLTSLTHLTIACDNLKQLPETFHHLTSLRELDLAGCGALTALPENIGKLSALEALYVGPCSAIQCLPESIKHLTNLRRLNISGCPNLVKRCEQEVGEDWQLVSHIPNLI

superfamily: SSF52540
44-292 SSF52540

NMIIGELSLLSNVEESKIPIRDQEMDTIVSMLVDSNEGENCWIVSVVGLGGSGKTTLAKHICHVNKIKELFKERIFWVHVSREFDVQKLIGKLYETIVGRKSDCQPQQQMVREISKQLCCNKFLLVLDDAWHTDGYEWGQFMVHLQDRSIGSRILLTTRDRKVAEVVKSKQIHELVFLTESESWSLFLKCSGWVEDDLGSEFIQLGKEILKKCGGVPLAIRTIAGVLCEKREISTWRAIRGSDLWNVGS

HMMPfam: PF00931
IPR002182
64-346 NB-ARC,NBS
NB-ARC

RDQEMDTIVSMLVDSNEGENCWIVSVVGLGGSGKTTLAKHICHVNKIKELFKERIFWVHVSREFDVQKLIGKLYETIVGRKSDCQPQQQMVREISKQLCCNKFLLVLDDAWHTDGYEWGQFMVHLQDRSIGSRILLTTRDRKVAEVVKSKQIHELVFLTESESWSLFLKCSGWVEDDLGSEFIQLGKEILKKCGGVPLAIRTIAGVLCEKREISTWRAIRGSDLWNVGSVNDRVFASLKLSYIHLADKLKQCFTFCSIFPKGYVINKDRLVAQWIAHGFITPM

Gene3D: G3DSA:3.40.50.300
64-190 G3DSA:3.40.50.300

RDQEMDTIVSMLVDSNEGENCWIVSVVGLGGSGKTTLAKHICHVNKIKELFKERIFWVHVSREFDVQKLIGKLYETIVGRKSDCQPQQQMVREISKQLCCNKFLLVLDDAWHTDGYEWGQFMVHLQD

FPrintScan: PR00364
IPR000767
86-101 DISEASERSIST
Disease resistance protein

IVSVVGLGGSGKTTLA

FPrintScan: PR00364
IPR000767
160-174 DISEASERSIST
Disease resistance protein

QLCCNKFLLVLDDAW

FPrintScan: PR00364
IPR000767
256-270 DISEASERSIST
Disease resistance protein

CGGVPLAIRTIAGVL

superfamily: SSF52058
381-755 SSF52058,LRR

KMHDLIHDLAQYCEKNEVVTSRPNSMSTYQTHKCRYLSLTSGNEKVKRGLLDKVHALYMSDGNLSFDKPVKKSCYIRSVILDNENCTTFPPVLLKFEFLGYLEIHGVDCKKLPEAISGCWNLQSLHFIRCSGFVMLPESVGKLKKLRTLELNYVIDLESLPQSIGDCQGLQSLQLHSCNKLQGMPTSIGRIENLRVLHITSCPCMQKLPSEPCGESNNLEIINLSNCHNFHGLPSTFACKALRTLNLYNTKITMLPQWVTSIDTLECLDLGYCHELMEFPKGIANLRRLAVLNLEGCSKLRCMPSGFRQLTRLTKMGLFVVGCDGDNARISELETLDMISGKMKIINLKYTLDPTDADKASLKRKNNIKYLELDW

Gene3D: G3DSA:3.80.10.10
431-697 G3DSA:3.80.10.10

LDKVHALYMSDGNLSFDKPVKKSCYIRSVILDNENCTTFPPVLLKFEFLGYLEIHGVDCKKLPEAISGCWNLQSLHFIRCSGFVMLPESVGKLKKLRTLELNYVIDLESLPQSIGDCQGLQSLQLHSCNKLQGMPTSIGRIENLRVLHITSCPCMQKLPSEPCGESNNLEIINLSNCHNFHGLPSTFACKALRTLNLYNTKITMLPQWVTSIDTLECLDLGYCHELMEFPKGIANLRRLAVLNLEGCSKLRCMPSGFRQLTRLTKMG

FPrintScan: PR00364
IPR000767
664-680 DISEASERSIST
Disease resistance protein

ANLRRLAVLNLEGCSKL

superfamily: SSF52058
876-1129 SSF52058,LRR

GDELQAKYCFPALSTLWIRGCPRLNVVPYFPSSLERLFLRESNDQLLSSGSFSHLLPPLAHESSPCSNAHSAVPRLKELTIIKMTGSSCGWDFLQYLDALEYFNIFGSNDLTQLPESMRSLTSLHKLIIHDCPTFGMLPEWLGELCSLQSLFIKGTPMMDSLPQSIGCLTSLTHLTIACDNLKQLPETFHHLTSLRELDLAGCGALTALPENIGKLSALEALYVGPCSAIQCLPESIKHLTNLRRLNISGCPNL

Gene3D: G3DSA:3.80.10.10
948-1129 G3DSA:3.80.10.10

VPRLKELTIIKMTGSSCGWDFLQYLDALEYFNIFGSNDLTQLPESMRSLTSLHKLIIHDCPTFGMLPEWLGELCSLQSLFIKGTPMMDSLPQSIGCLTSLTHLTIACDNLKQLPETFHHLTSLRELDLAGCGALTALPENIGKLSALEALYVGPCSAIQCLPESIKHLTNLRRLNISGCPNL

HMMPfam: PF13504
1068-1085 LRR_7,Leucine rich repeat

TSLRELDLAGCGALTALP


List of References

Hajime Ohyanagi, Tsuyoshi Tanaka, Hiroaki Sakai, Yasumasa Shigemoto, Kaori Yamaguchi, Takuya Habara, Yasuyuki Fujii, Baltazar A Antonio, Yoshiaki Nagamura, Tadashi Imanishi, Kazuho Ikeo, Takeshi Itoh, Takashi Gojobori, Takuji Sasaki
The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information.
Nucleic Acids Res.: 2006, 34(Database issue);D741-4
PubMed:16381971 WorldCat.org DOI (I p)


The map-based sequence of the rice genome.
Nature: 2005, 436(7052);793-800
PubMed:16100779 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox