PRGDB00050115 (RGA6)

From PRG Wiki
Revision as of 17:16, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
RGA6
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 154845413 (EU036668)
Gene Class Unknown
Domain Type
Gene Species Lolium perenne

Comment?

Lolium perenne RGA6 gene, partial cds.

DNA Sequence

ATGGCTGCAGAAGGTTGTGCTCAAGCTCGACCTGCACGACGACAAACAGAAGCAGAAGGCGCTCAAGCTCGCCTCCGCTCTCCCAGGTATGCTCTCCTGCTTCTTCCTCTTCTGCTCCTTTTGCTCTGCTTCGTGCTGGTTACGTTCTTGCCTTCATGCTCTGCTTCGGGTTGCTCTGAATTCTCAATTCTCCATCTGACGTAA


Protein sequences

Name Description Sequence
RGA6 RGA6 [Lolium perenne].

MAAEGCAQARPARRQTEAEGAQARLRSPRYALLLLPLLLLLLCFVLVTFLPSCSASGCSEFSILHLT







List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox