PRGDB00050495 (F2I11_300)

From PRG Wiki
Revision as of 17:36, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
F2I11_300
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 8953373 (AL360314)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana DNA chromosome 5, BAC clone F2I11 (ESSA project).

DNA Sequence

CCGCTTCATAATCTCAGGCAGATGGATTTGAGTTATTCTGTAAACTTGAAGGAGCTTCCTGATCTCTCAACTGCCATTAATCTCCGAAAGTTGATTCTTTCTAATTGCTCCAGTCTGATCAAACTCCCTTCTTGTATTGGGAATGCCATCAATCTCGAGGATTTAGATCTTAATGGATGCTCAAGTCTTGTGGAGCTTCCCTCTTTTGGGGATGCCATTAACCTTCAAAAATTGCTTCTTCGCTATTGCTCAAATCTGGTGGAGCTCCCCTCTTCTATTGGGAATGCCATTAATCTTCGGGAATTGGATCTTTATTATTGCTCGAGTCTGATCAGACTTCCCTCCTCTATTGGGAATGCCATTAATCTTTTGATTTTAGATCTTAACGGATGCTCAAATCTATTGGAGCTCCCATCCTCCATTGGGAATGCCATTAATCTCCAAAAACTGGATCTTCGCAGATGCGCAAAGCTATTAGAGCTCCCGTCTTCTATTGGGAATGCCATTAATCTCCAAAACCTGCTTCTTGACGATTGCTCAAGTCTGTTGGAGCTCCCCTCGTCTATTGGGAATGCCACTAATTTAGTGTACATGAACCTTAGTAATTGCTCAAATCTGGTGGAGCTTCCTCTTTCTATAGGAAACCTTCAGAAGTTGCAGGAATTGATTTTAAAAGGATGCTCTAAGCTAGAGGATCTTCCCATCAACATCAACTTGGAATCTTTGGACATACTTGTGCTCAATGATTGCTCCATGTTGAAAAGGTTTCCTGAGATCTCTACTAACGTTAGAGCTCTCTATCTCTGTGGAACCGCAATAGAAGAAGTGCCTCTCTCGATCAGGTCATGGCCCCGTCTTGATGAATTGCTGATGTCATACTTTGATAATCTAGTGGAATTCCCTCATGTTCTTGACATCATCACAAATCTGGACTTGAGCGGTAAAGAAATACAAGAGGTTCCTCCACTGATCAAGAGAATATCTCGTCTTCAGACACTCATACTCAAGGGGTACAGAAAGGTGGTATCACTCCCACAGATTCCAGATTCTTTAAAATGGATTGATGCTGAAGATTGTGAGTCCTTGGAGAGACTAGATTGCTCCTTTCACAATCCAGAGATTACTCTCTTCTTTGGTAAGTGCTTTAAACTTAATCAAGAAGCAAGAGACCTAATCATCCAGACACCGACTAAACAAGCAGTCTTACCTGGTAGAGAGGTGCCTGCATACTTCACTCACCGAGCGAGTGGGGGTTCATTGACAATTAAGTTGAATGAGAGGCCTCTTCCTACATCTATGAGATATAAGGCTTGCATCTTGCTAGTTCGTATTGGTGACTATGGCGCTCATGATAGAGACAAATGGTTACATGTTGCTTTCGGTGTTAGGTCTACAACATTGGGGCACATTATATATTCAGGCTTAACAGAGCATCTGTACACATTCGAAATCGAAGAGAAGGTGACTTCCAGCGAGCTTGTCTTTGAGTTCAAGGTCGAGAACGGTAACCACTGGAAGATTGGAGAATGCGGGTTACGCCAACTATCGTAAGGTAGTAAAAGTGTAATAGGCATAGATTTCCACTACATAATCGAGGAAGAATTCGATATGAATGAGAGAGTTTTTGAAGGAATGTCTAATCTTCAGTTCTTAAGATTCGATTGTGACCATGATACATTGCAATTATCCCGCGGTCTGAGCTATCTTTCTCGTAAACTTCAGTTACTAGATTGGATATATTTTCCGATGACATGTTTGCCTTCTACTGTGAACGTGGAGTTCCTTATTGAACTAAACCTGACGCACAGCAAGCTTGATATGTTGTGGGAAGGAGTTAAAGGATAATGAAGCGGCCATGATCAAGAAAATCGCCACTGATATTTCGAACATATTGATTAATTCCACTCCTTCACGTGATTTCGACGGGTTAGTTGGGATGAGAGCTCATTTAGAAAAGATGAAACCGTTGTTATGCCTAGACACAGACGAAGTAAGGATAATTGGGATTTGGGGTCCTCCTGGGATTGGGAAGACCACAATTGCCAGAGTTGTATACAACCAACTCTCCCACAGTTTCCAACTGAGTGTCTTTATGGAGAATATCAAAGCAAACTATACCAGACCAACTGGCTCCGATGACTACAGTGCAAAGTTGCAATTACAACAAATGTTTATGTCTCAAATAACCAAGCAAAAGGATATAGAGATTCCTCATTTAGGAGTTGCCCAAGATAGGTTGAAAGACAAGAAAGTTCTGGTCGTTCTTGATGGGGTGAACCAGTCAGTACAACTAGATGCGATGGCGAAAGAAGCTTGGTGGTTTGGTCCTGGGAGTCGAATCATCATTACAACACAAGATCAGAAACTTTTTAGAGCACATGGGATTAACCATATTTACAAGGTGGATTTTCCACCAACTGAAGAGGCTCTTCAAATCTTCTGCATGTATGCTTTTGGTCAAAATTCCCCTAAAGATGGTTTTCAGAACCTTGCTTGGAAAGTAATAAATCTTGCCGGTAACCTCCCTTTGGGGCTAAGAATTATGGGCTCCTATTTTAGGGGAATGTCGAGAGAAGAGTGGAAAAAGTCATTACCAAGATTAGAGAGTAGCCTTGACGCTGATATTCAAAGCATTTTGAAGTTCAGCTATGACGCTTTAGATGACGAAGATAAAAATTTATTTCTTCATATAGCATGTTTTTTCAACGGTAAAGAGATTAAGATATTGGAAGAGCATCTTGCAAAGAAGTTTGTGGAAGTCAGGCAAAGACTTAACGTCTTAGCTGAGAAATCTCTCATATCTTTTAGCAATTGGGGAACTATAGAGATGCATAAACTGCTAGCAAAACTAGGTGGAGAAATTGTTCGTAACCAATCTATCCATGAGCCTGGACAACGCCAGTTTTTGTTTGATGGAGAAGAGATATGTGATGTGCTGAATGGTGATGCAGCAATGGCTTCTTCGTTTTTCCTTACCACTGTTGCAGCTGCAATAGGCTTCTTCACCCTTTTGAGAAAACTCAGATTCCATCATGATAACAAAGAAAAGAAGTCAACTTCTTTATCTCCTTCATCATCTCCATCTTCTTTGTCTCCTTCATCAGTTCCTCCACCTTCTTCGTCTTGCATCTGGACACACCAAGTCTTTCCCAGCTTCAGCGGGGAAGATGTCCGTAGAGACTTTCTCAGTCACATTCAGATGGAGTTTCAAAGAATGGGAATCACTCCATTCGTTGATAATGAGATTAAAAGAGGAGAATCCATCGGTCCTGAGCTTCTGCGGGCTATTAGAGGGTCTAAGATAGCAATTATCTTGCTCTCTAGGAACTATGCTTCTTCAAAATGGTGTCTTGACGAACTGGTGGAGATTATGAAATGCAGAGAAGAGTATGGTCAAACTGTGATGGCCATATTTTACAAAGTGGATCCTTCTGATGTAAAAAATCTGACCGGAGATTTCGGGAAAGTCTTTAGAAAAACTTGTGCCGGTAAACCAAAGAAGGACATTGGGAGATGGAGACAAGCTTGGGAAAAAGTGGCCACAGTAGCTGGTTACCATTCAATCAACTG


Protein sequences

Name Description Sequence
RPP1 disease resistance protein-like RPP1 disease resistance protein-like [Arabidopsis thaliana].

MASSFFLTTVAAAIGFFTLLRKLRFHHDNKEKKSTSLSPSSSPSSLSPSSVPPPSSSCIWTHQVFPSFSGEDVRRDFLSHIQMEFQRMGITPFVDNEIKRGESIGPELLRAIRGSKIAIILLSRNYASSKWCLDELVEIMKCREEYGQTVMAIFYKVDPSDVKNLTGDFGKVFRKTCAGKPKKDIGRWRQAWEKVATVAGYHSINWDNEAAMIKKIATDISNILINSTPSRDFDGLVGMRAHLEKMKPLLCLDTDEVRIIGIWGPPGIGKTTIARVVYNQLSHSFQLSVFMENIKANYTRPTGSDDYSAKLQLQQMFMSQITKQKDIEIPHLGVAQDRLKDKKVLVVLDGVNQSVQLDAMAKEAWWFGPGSRIIITTQDQKLFRAHGINHIYKVDFPPTEEALQIFCMYAFGQNSPKDGFQNLAWKVINLAGNLPLGLRIMGSYFRGMSREEWKKSLPRLESSLDADIQSILKFSYDALDDEDKNLFLHIACFFNGKEIKILEEHLAKKFVEVRQRLNVLAEKSLISFSNWGTIEMHKLLAKLGGEIVRNQSIHEPGQRQFLFDGEEICDVLNGDAAGSKSVIGIDFHYIIEEEFDMNERVFEGMSNLQFLRFDCDHDTLQLSRGLSYLSRKLQLLDWIYFPMTCLPSTVNVEFLIELNLTHSKLDMLWEGVKPLHNLRQMDLSYSVNLKELPDLSTAINLRKLILSNCSSLIKLPSCIGNAINLEDLDLNGCSSLVELPSFGDAINLQKLLLRYCSNLVELPSSIGNAINLRELDLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGNAINLQNLLLDDCSSLLELPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPININLESLDILVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLVEFPHVLDIITNLDLSGKEIQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHNPEITLFFGKCFKLNQEARDLIIQTPTKQAVLPGREVPAYFTHRASGGSLTIKLNERPLPTSMRYKACILLVRIGDYGAHDRDKWLHVAFGVRSTTLGHIIYSGLTEHLYTFEIEEKVTSSELVFEFKVENGNHWKIGECGLRQLS

Domains

Domain Start-End Description Sequence

ProfileScan: PS50104
IPR000157
60-198 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WTHQVFPSFSGEDVRRDFLSHIQMEFQRMGITPFVDNEIKRGESIGPELLRAIRGSKIAIILLSRNYASSKWCLDELVEIMKCREEYGQTVMAIFYKVDPSDVKNLTGDFGKVFRKTCAGKPKKDIGRWRQAWEKVATV

Gene3D: G3DSA:3.40.50.10140
60-197 G3DSA:3.40.50.10140

WTHQVFPSFSGEDVRRDFLSHIQMEFQRMGITPFVDNEIKRGESIGPELLRAIRGSKIAIILLSRNYASSKWCLDELVEIMKCREEYGQTVMAIFYKVDPSDVKNLTGDFGKVFRKTCAGKPKKDIGRWRQAWEKVAT

HMMSmart: SM00255
IPR000157
61-198 TIR
Toll/interleukin-1 receptor homology (TIR) domain

THQVFPSFSGEDVRRDFLSHIQMEFQRMGITPFVDNEIKRGESIGPELLRAIRGSKIAIILLSRNYASSKWCLDELVEIMKCREEYGQTVMAIFYKVDPSDVKNLTGDFGKVFRKTCAGKPKKDIGRWRQAWEKVATV

HMMPfam: PF01582
IPR000157
64-191 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFSGEDVRRDFLSHIQMEFQRMGITPFVDNEIKRGESIGPELLRAIRGSKIAIILLSRNYASSKWCLDELVEIMKCREEYGQTVMAIFYKVDPSDVKNLTGDFGKVFRKTCAGKPKKDIGRWRQA

superfamily: SSF52540
115-488 SSF52540

SKIAIILLSRNYASSKWCLDELVEIMKCREEYGQTVMAIFYKVDPSDVKNLTGDFGKVFRKTCAGKPKKDIGRWRQAWEKVATVAGYHSINWDNEAAMIKKIATDISNILINSTPSRDFDGLVGMRAHLEKMKPLLCLDTDEVRIIGIWGPPGIGKTTIARVVYNQLSHSFQLSVFMENIKANYTRPTGSDDYSAKLQLQQMFMSQITKQKDIEIPHLGVAQDRLKDKKVLVVLDGVNQSVQLDAMAKEAWWFGPGSRIIITTQDQKLFRAHGINHIYKVDFPPTEEALQIFCMYAFGQNSPKDGFQNLAWKVINLAGNLPLGLRIMGSYFRGMSREEWKKSLPRLESSLDADIQSILKFSYDALDDEDKNLFL

HMMPanther: PTHR23155
122-1080 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LSRNYASSKWCLDELVEIMKCREEYGQTVMAIFYKVDPSDVKNLTGDFGKVFRKTCAGKPKKDIGRWRQAWEKVATVAGYHSINWDNEAAMIKKIATDISNILINSTPSRDFDGLVGMRAHLEKMKPLLCLDTDEVRIIGIWGPPGIGKTTIARVVYNQLSHSFQLSVFMENIKANYTRPTGSDDYSAKLQLQQMFMSQITKQKDIEIPHLGVAQDRLKDKKVLVVLDGVNQSVQLDAMAKEAWWFGPGSRIIITTQDQKLFRAHGINHIYKVDFPPTEEALQIFCMYAFGQNSPKDGFQNLAWKVINLAGNLPLGLRIMGSYFRGMSREEWKKSLPRLESSLDADIQSILKFSYDALDDEDKNLFLHIACFFNGKEIKILEEHLAKKFVEVRQRLNVLAEKSLISFSNWGTIEMHKLLAKLGGEIVRNQSIHEPGQRQFLFDGEEICDVLNGDAAGSKSVIGIDFHYIIEEEFDMNERVFEGMSNLQFLRFDCDHDTLQLSRGLSYLSRKLQLLDWIYFPMTCLPSTVNVEFLIELNLTHSKLDMLWEGVKPLHNLRQMDLSYSVNLKELPDLSTAINLRKLILSNCSSLIKLPSCIGNAINLEDLDLNGCSSLVELPSFGDAINLQKLLLRYCSNLVELPSSIGNAINLRELDLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGNAINLQNLLLDDCSSLLELPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPININLESLDILVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLVEFPHVLDIITNLDLSGKEIQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHNPEITLFFGKCFKLNQEARDLIIQTPTKQAVLPGREV

HMMPanther: PTHR23155:SF292
122-1080 PTHR23155:SF292,SUBFAMILY NOT NAMED

LSRNYASSKWCLDELVEIMKCREEYGQTVMAIFYKVDPSDVKNLTGDFGKVFRKTCAGKPKKDIGRWRQAWEKVATVAGYHSINWDNEAAMIKKIATDISNILINSTPSRDFDGLVGMRAHLEKMKPLLCLDTDEVRIIGIWGPPGIGKTTIARVVYNQLSHSFQLSVFMENIKANYTRPTGSDDYSAKLQLQQMFMSQITKQKDIEIPHLGVAQDRLKDKKVLVVLDGVNQSVQLDAMAKEAWWFGPGSRIIITTQDQKLFRAHGINHIYKVDFPPTEEALQIFCMYAFGQNSPKDGFQNLAWKVINLAGNLPLGLRIMGSYFRGMSREEWKKSLPRLESSLDADIQSILKFSYDALDDEDKNLFLHIACFFNGKEIKILEEHLAKKFVEVRQRLNVLAEKSLISFSNWGTIEMHKLLAKLGGEIVRNQSIHEPGQRQFLFDGEEICDVLNGDAAGSKSVIGIDFHYIIEEEFDMNERVFEGMSNLQFLRFDCDHDTLQLSRGLSYLSRKLQLLDWIYFPMTCLPSTVNVEFLIELNLTHSKLDMLWEGVKPLHNLRQMDLSYSVNLKELPDLSTAINLRKLILSNCSSLIKLPSCIGNAINLEDLDLNGCSSLVELPSFGDAINLQKLLLRYCSNLVELPSSIGNAINLRELDLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGNAINLQNLLLDDCSSLLELPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPININLESLDILVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLVEFPHVLDIITNLDLSGKEIQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHNPEITLFFGKCFKLNQEARDLIIQTPTKQAVLPGREV

Gene3D: G3DSA:3.40.50.300
225-269 G3DSA:3.40.50.300

INSTPSRDFDGLVGMRAHLEKMKPLLCLDTDEVRIIGIWGPPGIG

HMMPfam: PF00931
IPR002182
241-501 NB-ARC,NBS
NB-ARC

AHLEKMKPLLCLDTDEVRIIGIWGPPGIGKTTIARVVYNQLSHSFQLSVFMENIKANYTRPTGSDDYSAKLQLQQMFMSQITKQKDIEIPHLGVAQDRLKDKKVLVVLDGVNQSVQLDAMAKEAWWFGPGSRIIITTQDQKLFRAHGINHIYKVDFPPTEEALQIFCMYAFGQNSPKDGFQNLAWKVINLAGNLPLGLRIMGSYFRGMSREEWKKSLPRLESSLDADIQSILKFSYDALDDEDKNLFLHIACFFNGKEIKI

FPrintScan: PR00364
IPR000767
259-274 DISEASERSIST
Disease resistance protein

IIGIWGPPGIGKTTIA

Gene3D: G3DSA:3.40.50.300
270-308 G3DSA:3.40.50.300

KTTIARVVYNQLSHSFQLSVFMENIKANYTRPTGSDDYS

FPrintScan: PR00364
IPR000767
338-352 DISEASERSIST
Disease resistance protein

RLKDKKVLVVLDGVN

Gene3D: G3DSA:3.40.50.300
343-406 G3DSA:3.40.50.300

KVLVVLDGVNQSVQLDAMAKEAWWFGPGSRIIITTQDQKLFRAHGINHIYKVDFPPTEEALQIF

FPrintScan: PR00364
IPR000767
431-445 DISEASERSIST
Disease resistance protein

AGNLPLGLRIMGSYF

superfamily: SSF46785
466-573 SSF46785

ADIQSILKFSYDALDDEDKNLFLHIACFFNGKEIKILEEHLAKKFVEVRQRLNVLAEKSLISFSNWGTIEMHKLLAKLGGEIVRNQSIHEPGQRQFLFDGEEICDVLN

superfamily: SSF52058
606-907 SSF52058,LRR

SNLQFLRFDCDHDTLQLSRGLSYLSRKLQLLDWIYFPMTCLPSTVNVEFLIELNLTHSKLDMLWEGVKPLHNLRQMDLSYSVNLKELPDLSTAINLRKLILSNCSSLIKLPSCIGNAINLEDLDLNGCSSLVELPSFGDAINLQKLLLRYCSNLVELPSSIGNAINLRELDLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGNAINLQNLLLDDCSSLLELPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLP

HMMPfam: PF07725
IPR011713
654-673 LRR_3
Leucine-rich repeat 3

FLIELNLTHSKLDMLWEGVK

Gene3D: G3DSA:3.80.10.10
660-868 G3DSA:3.80.10.10

LTHSKLDMLWEGVKPLHNLRQMDLSYSVNLKELPDLSTAINLRKLILSNCSSLIKLPSCIGNAINLEDLDLNGCSSLVELPSFGDAINLQKLLLRYCSNLVELPSSIGNAINLRELDLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGNAINLQNLLLDDCSSLLELPSSIGNATNL

HMMPfam: PF00560
IPR001611
724-743 LRR_1
Leucine-rich repeat

NLEDLDLNGCSSLVELPSFG

HMMPfam: PF00560
IPR001611
819-840 LRR_1
Leucine-rich repeat

NLQKLDLRRCAKLLELPSSIGN

superfamily: SSF52058
843-1057 SSF52058,LRR

NLQNLLLDDCSSLLELPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPININLESLDILVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLVEFPHVLDIITNLDLSGKEIQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHNPEITLFFGKCFKL

HMMPfam: PF00560
IPR001611
867-889 LRR_1
Leucine-rich repeat

NLVYMNLSNCSNLVELPLSIGNL

Gene3D: G3DSA:3.80.10.10
869-1041 G3DSA:3.80.10.10

VYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPININLESLDILVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLVEFPHVLDIITNLDLSGKEIQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCS

FPrintScan: PR00364
IPR000767
887-903 DISEASERSIST
Disease resistance protein

GNLQKLQELILKGCSKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox