PRGDB00050500 (AT4g14780)

From PRG Wiki
Revision as of 17:37, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
AT4g14780
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 7268147 (AL161539)
Gene Class NL
Domain Type LRR, NBS, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana DNA chromosome 4, contig fragment No. 39.

DNA Sequence

AGGTTGAGGAAGAATCTTTCAAAATATTAACTTTTCCAAGCATGTGTAATATCCGTCGAATTGGCATATGGAAGTGTGGAATGAAGGAGATAAAAGTCGAGATGAGAACATCATCATGCTTCTCTAGCCTCTCCAAAGTCGTTATAGGACAATGTGATGGTCTAAAGGAGTTGACATGGCTATTGTTTGCTCCAAACCTTACTTATCTCGACGCTCGTTTCGCAGAGCAACTAGAGGATATAATCAGTGAAGAAAAAGCTGCAAGTGTTACGGACGAGAATGCAAGTATTATCATTCCTTTTCAAAAACTAGAATGTCTTAGCTTATCTGATTTACCTAAGCTAAAGAGCATCTACTGGTCACCATTGTCTTTTCCACGTCTGAGTGAGCTTGCAGTGCAAGAACATTGTCCAAAGCTGAAAAAGCTTCCATTGAACTCCAAGAGTGGAACTGCAGGTGTAGAACTTGTCGTAAAATACGGCGAAAACAAATGGTTAGAAGGTGTTGAATGGGAAGACAAAGCCACTGAACTACGGTTTTTGGCTACCTGCAAATCGTTGTATCGATGAAGTTGAAACAACTAATACATCTGAATTTGGAGTCCATGAAGAGTTTGGAGAGTATGCTGGGGTATCTAAGTTGTTGAGTTTGAAGACACTGAGACTACAAAAGTCCAAAAAGGCTCTAGATGTGAACTCAGCGAAGGAGCTACAACTCTTAGAACATATAGAAGTTCTAACCATAGATATCTTTTCAAGAAGAATGGAAGAAAACGGAAGTGAAAATGCATGACGTGGTTCGTGAGATGGCTCTATGGATATCATCTGATCTTGGAAAGCATAAAGATCAATGCATTGTGCGAGCCGGTGTTGGGTTACATGCAGTACCGGAAGTGAAGAACTGGAGAGCTGTGAGAAGAATGTCGTTGATGAAAAATGAGCTTGAAAAGATTTTGGGTTGCCCTACATGTCCTCAACTTACAACTCTCCTCCTCCAAAAAAACCACAAATTGGTAAATATTTCCGGAGAATTCTTTCGATTCATGCCTAACCTTGTCGTATTGGATTTATCATGGAATAGTAGTCTCACTGGATTACCAAAGAAAATATCAGAGTTGAGATAGAGAGGTTGTGTTTTTGTGGGTTTTGCTCCAAAAGTTTTGGAAAGAGCTATCATTATGGGAAAATGGTTAGCGTGATGTTGAAGGAAGTTGAGAATCTCTCTTCTCGTGGAGTATTTGATGTGGTGACTGAGGAAAATCTGGTAGCTCAAGTTGAGGAGATGCCTATTCAATCCACAGTTGTTGGTCAAGAGACAATGCTTGAAAGGGTTTGGAACACTCTCATGAAAGATGGATTCAAGATCATGGGTTTATATGGAATGGGTGGAGTGGGAAAAACCACGCTTCTTACGCAAATCAACAAGAAGTTTTCTGAAACAGATGGTGGATTTGATATTGTGATGTGGGTTGTTGTGTCTAAAACCTCAGAGATCTATAGGATTCAAGAAGACATTGCAAAAAGACTAGGTCTTACGGGCGAGGAGTGGGACAAAAAAAACGAAAACAAGAGAGCCGTTGACATACACAATGTCCTTAGGAGACATAAATTTGTGTTATTGTTGGATGATATATGGGAGAAAGTGAACTTAGAATTGGTTGGAGTACCGTATCCAAGTAGAGAAAATGGAAGCATAGTAGCATTTACCACCCGTTCTCGAGATGTTTGTGGGCGTATGGGAGTCGATGACCCGATGCAAGTTAGTTGTTTGGAACCTGAAGATGCTTGGGATTTGTTTCAAAACAAAGTAGGAGAAAACACTTTGAAAAGCCATCCGGATATTCCTGAACTTGCAAAACAAGTCGCTGAAAAATGTCGTGGTCTACCATTAGCACTTAATGTCATTGGAGAAACTATGGCATGCAAAAGCACAGTTCAAGAATGGCGTCACGCGATTGATTTTGTGAATCAGTTCTCTCAATGGTTATGCGTTAGAAAAGGTTACATTCATAGCCTTCCCGAGAATCTAGCAGCTCTACAAAAAGCCATTGAAGTTCTCAAGACAAAGCACGATGATGTGAAAAGAAGGGTCGATAAAGAAGAATTTCTAGGGCGTCGTCATAGGCTTTCTCAAGTTCAGATGGCGTTAACCAAGTTAAGA


Protein sequences

Name Description Sequence
disease resistance RPS2 like protein disease resistance RPS2 like protein [Arabidopsis thaliana].

MALTKLRFVNQFSQWLCVRKGYIHSLPENLAALQKAIEVLKTKHDDVKRRVDKEEFLGRRHRLSQVQVEIERLCFCGFCSKSFGKSYHYGKMVSVMLKEVENLSSRGVFDVVTEENLVAQVEEMPIQSTVVGQETMLERVWNTLMKDGFKIMGLYGMGGVGKTTLLTQINKKFSETDGGFDIVMWVVVSKTSEIYRIQEDIAKRLGLTGEEWDKKNENKRAVDIHNVLRRHKFVLLLDDIWEKVNLELVGVPYPSRENGSIVAFTTRSRDVCGRMGVDDPMQVSCLEPEDAWDLFQNKVGENTLKSHPDIPELAKQVAEKCRGLPLALNVIGETMACKSTVQEWRHAIDEEWKKTEVKMHDVVREMALWISSDLGKHKDQCIVRAGVGLHAVPEVKNWRAVRRMSLMKNELEKILGCPTCPQLTTLLLQKNHKLVNISGEFFRFMPNLVVLDLSWNSSLTGLPKKISEVETTNTSEFGVHEEFGEYAGVSKLLSLKTLRLQKSKKALDVNSAKELQLLEHIEVLTIDIFSKVEEESFKILTFPSMCNIRRIGIWKCGMKEIKVEMRTSSCFSSLSKVVIGQCDGLKELTWLLFAPNLTYLDARFAEQLEDIISEEKAASVTDENASIIIPFQKLECLSLSDLPKLKSIYWSPLSFPRLSELAVQEHCPKLKKLPLNSKSGTAGVELVVKYGENKWLEGVEWEDKATELRFLATCKSLYR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF119
1-711 PTHR23155:SF119,RFL1 (RPS5-LIKE 1)

MALTKLRFVNQFSQWLCVRKGYIHSLPENLAALQKAIEVLKTKHDDVKRRVDKEEFLGRRHRLSQVQVEIERLCFCGFCSKSFGKSYHYGKMVSVMLKEVENLSSRGVFDVVTEENLVAQVEEMPIQSTVVGQETMLERVWNTLMKDGFKIMGLYGMGGVGKTTLLTQINKKFSETDGGFDIVMWVVVSKTSEIYRIQEDIAKRLGLTGEEWDKKNENKRAVDIHNVLRRHKFVLLLDDIWEKVNLELVGVPYPSRENGSIVAFTTRSRDVCGRMGVDDPMQVSCLEPEDAWDLFQNKVGENTLKSHPDIPELAKQVAEKCRGLPLALNVIGETMACKSTVQEWRHAIDEEWKKTEVKMHDVVREMALWISSDLGKHKDQCIVRAGVGLHAVPEVKNWRAVRRMSLMKNELEKILGCPTCPQLTTLLLQKNHKLVNISGEFFRFMPNLVVLDLSWNSSLTGLPKKISEVETTNTSEFGVHEEFGEYAGVSKLLSLKTLRLQKSKKALDVNSAKELQLLEHIEVLTIDIFSKVEEESFKILTFPSMCNIRRIGIWKCGMKEIKVEMRTSSCFSSLSKVVIGQCDGLKELTWLLFAPNLTYLDARFAEQLEDIISEEKAASVTDENASIIIPFQKLECLSLSDLPKLKSIYWSPLSFPRLSELAVQEHCPKLKKLPLNSKSGTAGVELVVKYGENKWLEGVEWEDKATELRFL

HMMPanther: PTHR23155
1-711 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MALTKLRFVNQFSQWLCVRKGYIHSLPENLAALQKAIEVLKTKHDDVKRRVDKEEFLGRRHRLSQVQVEIERLCFCGFCSKSFGKSYHYGKMVSVMLKEVENLSSRGVFDVVTEENLVAQVEEMPIQSTVVGQETMLERVWNTLMKDGFKIMGLYGMGGVGKTTLLTQINKKFSETDGGFDIVMWVVVSKTSEIYRIQEDIAKRLGLTGEEWDKKNENKRAVDIHNVLRRHKFVLLLDDIWEKVNLELVGVPYPSRENGSIVAFTTRSRDVCGRMGVDDPMQVSCLEPEDAWDLFQNKVGENTLKSHPDIPELAKQVAEKCRGLPLALNVIGETMACKSTVQEWRHAIDEEWKKTEVKMHDVVREMALWISSDLGKHKDQCIVRAGVGLHAVPEVKNWRAVRRMSLMKNELEKILGCPTCPQLTTLLLQKNHKLVNISGEFFRFMPNLVVLDLSWNSSLTGLPKKISEVETTNTSEFGVHEEFGEYAGVSKLLSLKTLRLQKSKKALDVNSAKELQLLEHIEVLTIDIFSKVEEESFKILTFPSMCNIRRIGIWKCGMKEIKVEMRTSSCFSSLSKVVIGQCDGLKELTWLLFAPNLTYLDARFAEQLEDIISEEKAASVTDENASIIIPFQKLECLSLSDLPKLKSIYWSPLSFPRLSELAVQEHCPKLKKLPLNSKSGTAGVELVVKYGENKWLEGVEWEDKATELRFL

superfamily: SSF52540
111-359 SSF52540

VVTEENLVAQVEEMPIQSTVVGQETMLERVWNTLMKDGFKIMGLYGMGGVGKTTLLTQINKKFSETDGGFDIVMWVVVSKTSEIYRIQEDIAKRLGLTGEEWDKKNENKRAVDIHNVLRRHKFVLLLDDIWEKVNLELVGVPYPSRENGSIVAFTTRSRDVCGRMGVDDPMQVSCLEPEDAWDLFQNKVGENTLKSHPDIPELAKQVAEKCRGLPLALNVIGETMACKSTVQEWRHAIDEEWKKTEVKM

HMMPfam: PF00931
IPR002182
133-412 NB-ARC,NBS
NB-ARC

QETMLERVWNTLMKDGFKIMGLYGMGGVGKTTLLTQINKKFSETDGGFDIVMWVVVSKTSEIYRIQEDIAKRLGLTGEEWDKKNENKRAVDIHNVLRRHKFVLLLDDIWEKVNLELVGVPYPSRENGSIVAFTTRSRDVCGRMGVDDPMQVSCLEPEDAWDLFQNKVGENTLKSHPDIPELAKQVAEKCRGLPLALNVIGETMACKSTVQEWRHAIDEEWKKTEVKMHDVVREMALWISSDLGKHKDQCIVRAGVGLHAVPEVKNWRAVRRMSLMKNELE

Gene3D: G3DSA:3.40.50.300
145-241 G3DSA:3.40.50.300

MKDGFKIMGLYGMGGVGKTTLLTQINKKFSETDGGFDIVMWVVVSKTSEIYRIQEDIAKRLGLTGEEWDKKNENKRAVDIHNVLRRHKFVLLLDDIW

FPrintScan: PR00364
IPR000767
151-166 DISEASERSIST
Disease resistance protein

IMGLYGMGGVGKTTLL

FPrintScan: PR00364
IPR000767
227-241 DISEASERSIST
Disease resistance protein

VLRRHKFVLLLDDIW

FPrintScan: PR00364
IPR000767
321-335 DISEASERSIST
Disease resistance protein

CRGLPLALNVIGETM

superfamily: SSF52058
358-677 SSF52058,LRR

KMHDVVREMALWISSDLGKHKDQCIVRAGVGLHAVPEVKNWRAVRRMSLMKNELEKILGCPTCPQLTTLLLQKNHKLVNISGEFFRFMPNLVVLDLSWNSSLTGLPKKISEVETTNTSEFGVHEEFGEYAGVSKLLSLKTLRLQKSKKALDVNSAKELQLLEHIEVLTIDIFSKVEEESFKILTFPSMCNIRRIGIWKCGMKEIKVEMRTSSCFSSLSKVVIGQCDGLKELTWLLFAPNLTYLDARFAEQLEDIISEEKAASVTDENASIIIPFQKLECLSLSDLPKLKSIYWSPLSFPRLSELAVQEHCPKLKKLPLNS

Gene3D: G3DSA:3.80.10.10
390-678 G3DSA:3.80.10.10

HAVPEVKNWRAVRRMSLMKNELEKILGCPTCPQLTTLLLQKNHKLVNISGEFFRFMPNLVVLDLSWNSSLTGLPKKISEVETTNTSEFGVHEEFGEYAGVSKLLSLKTLRLQKSKKALDVNSAKELQLLEHIEVLTIDIFSKVEEESFKILTFPSMCNIRRIGIWKCGMKEIKVEMRTSSCFSSLSKVVIGQCDGLKELTWLLFAPNLTYLDARFAEQLEDIISEEKAASVTDENASIIIPFQKLECLSLSDLPKLKSIYWSPLSFPRLSELAVQEHCPKLKKLPLNSK

FPrintScan: PR00364
IPR000767
443-459 DISEASERSIST
Disease resistance protein

RFMPNLVVLDLSWNSSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox