PRGDB00050631 (Pto-like receptor kinase resistance protein)

From PRG Wiki
Revision as of 17:47, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Pto-like receptor kinase resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 47498959 (AY583625)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Rosa roxburghii

Comment?

Rosa roxburghii clone STK6 Pto-like receptor kinase resistance protein gene, partial cds.

DNA Sequence

TGGGCGAGGGTGGTTTTGGGAAGGTTTACAAAGGGTTGATTGATGGAGCGTCGACGGAAGTGGCTATAAAGAGATCCAATCCATCTTCCGAACAAGGAGTTAATGAGTTCCAAACTGAAATCGAGATGCTTTCGAGGCTTAGGCACAGGCATTTGGTCTCCTTGATTGGTTTTTGTGAAGAAGAAGGCGAGATGATTTTGGTTTATGATTACATGGCTAATGGGACTCTTAGGGAGCACCTCTACAAGTGCAACAAGCCTCCATTGTCATGGAAGCAAAGGTTGGAAATTTGTATAGGAGCTGCGAGGGGACTGCATTATCTTCATACAGGTGCAAGGTACACTATCATCCATAGAGATGTGAAAACAACAAACATTCTTTTGGATGAGAATTGGGTAGCTAAAGTCTCTGATTTCGGGCTATCCAAAACGGGGCCTAATCTTCACCAAACCCATGTTAGTACAATGGTGAAGGGTAGCTTCGGGTACTTGGACCCTGAATACTTCCGCAGGCAACAATTGACTGAAAAATCAGACGTTTATTCATTCGGTGT


Protein sequences

Name Description Sequence
Pto-like receptor kinase resistance protein Pto-like receptor kinase resistance protein [Rosa roxburghii].

GEGGFGKVYKGLIDGASTEVAIKRSNPSSEQGVNEFQTEIEMLSRLRHRHLVSLIGFCEEEGEMILVYDYMANGTLREHLYKCNKPPLSWKQRLEICIGAARGLHYLHTGARYTIIHRDVKTTNILLDENWVAKVSDFGLSKTGPNLHQTHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-184 PTHR24420,FAMILY NOT NAMED

GEGGFGKVYKGLIDGASTEVAIKRSNPSSEQGVNEFQTEIEMLSRLRHRHLVSLIGFCEEEGEMILVYDYMANGTLREHLYKCNKPPLSWKQRLEICIGAARGLHYLHTGARYTIIHRDVKTTNILLDENWVAKVSDFGLSKTGPNLHQTHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGV

ProfileScan: PS50011
IPR000719
1-184 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

GEGGFGKVYKGLIDGASTEVAIKRSNPSSEQGVNEFQTEIEMLSRLRHRHLVSLIGFCEEEGEMILVYDYMANGTLREHLYKCNKPPLSWKQRLEICIGAARGLHYLHTGARYTIIHRDVKTTNILLDENWVAKVSDFGLSKTGPNLHQTHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGV

HMMPfam: PF07714
IPR001245
1-184 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

GEGGFGKVYKGLIDGASTEVAIKRSNPSSEQGVNEFQTEIEMLSRLRHRHLVSLIGFCEEEGEMILVYDYMANGTLREHLYKCNKPPLSWKQRLEICIGAARGLHYLHTGARYTIIHRDVKTTNILLDENWVAKVSDFGLSKTGPNLHQTHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGV

Gene3D: G3DSA:3.30.200.20
1-56 G3DSA:3.30.200.20

GEGGFGKVYKGLIDGASTEVAIKRSNPSSEQGVNEFQTEIEMLSRLRHRHLVSLIG

superfamily: SSF56112
IPR011009
1-184 Kinase_like
Protein kinase-like domain

GEGGFGKVYKGLIDGASTEVAIKRSNPSSEQGVNEFQTEIEMLSRLRHRHLVSLIGFCEEEGEMILVYDYMANGTLREHLYKCNKPPLSWKQRLEICIGAARGLHYLHTGARYTIIHRDVKTTNILLDENWVAKVSDFGLSKTGPNLHQTHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGV

HMMPanther: PTHR24420:SF418
1-184 PTHR24420:SF418,SUBFAMILY NOT NAMED

GEGGFGKVYKGLIDGASTEVAIKRSNPSSEQGVNEFQTEIEMLSRLRHRHLVSLIGFCEEEGEMILVYDYMANGTLREHLYKCNKPPLSWKQRLEICIGAARGLHYLHTGARYTIIHRDVKTTNILLDENWVAKVSDFGLSKTGPNLHQTHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGV

Gene3D: G3DSA:1.10.510.10
57-184 G3DSA:1.10.510.10

FCEEEGEMILVYDYMANGTLREHLYKCNKPPLSWKQRLEICIGAARGLHYLHTGARYTIIHRDVKTTNILLDENWVAKVSDFGLSKTGPNLHQTHVSTMVKGSFGYLDPEYFRRQQLTEKSDVYSFGV

PatternScan: PS00108
IPR008271
115-127 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKTTNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox