PRGDB00050699 (NBS-LRR-like protein CR374)

From PRG Wiki
Revision as of 17:54, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
NBS-LRR-like protein CR374
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 31616486 (AY310369)
Gene Class NL
Domain Type NBS, LRR
Gene Species Oryza sativa Indica Group

Comment?

Oryza sativa (indica cultivar-group) NBS-LRR-like protein CR374 gene, partial cds.

DNA Sequence

GGACCAGGGGGGTCGGGGAAAACGACACTTGCTCGATTGGTGTACCATGACCCAGAAGTAAAAGATAAATTTGACATCATGCTCTGGATCTACGTATCTGCTAACTTTGATGAAGTTAAGCTTACACAAGGGATTCTGGAACAAATACCTGAATGTGAGTTCAAAAGCGCCAAGAATCTCACTGTGCTTCAGCGTGGTATCAACAAATATTTGACCAAACGATTTCTGCTTGTTCTGGATGACATGTGGGAAGAGAGTGAGGGTCGTTGGGACAAGTTATTGGCCCCACTTAGATCCGCACAGGCTAAGGGTAACGTACTCTTGGTAACTACTCGGAAGTTATCGGTGGCTAGGATAACTAGCAACACAGAAGCACACATTGACTTGGATGGTATGAAAAAAGATGACTTCTGGTTATTCTTCAAAAGATGCATATTTGGTGATGAAAACTATCAAGGCCAAAGGAAGCTACAGAATATTGCTAAGAAAATAGCCACCAGACTGAATGGCAACCCCTTCGCCGC


Protein sequences

Name Description Sequence
NBS-LRR-like protein CR374 NBS-LRR-like protein CR374 [Oryza sativa (indica cultivar-group)].

GPGGSGKTTLARLVYHDPEVKDKFDIMLWIYVSANFDEVKLTQGILEQIPECEFKSAKNLTVLQRGINKYLTKRFLLVLDDMWEESEGRWDKLLAPLRSAQAKGNVLLVTTRKLSVARITSNTEAHIDLDGMKKDDFWLFFKRCIFGDENYQGQRKLQNIAKKIATRLNGNPFAA


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.300
1-115 G3DSA:3.40.50.300

GPGGSGKTTLARLVYHDPEVKDKFDIMLWIYVSANFDEVKLTQGILEQIPECEFKSAKNLTVLQRGINKYLTKRFLLVLDDMWEESEGRWDKLLAPLRSAQAKGNVLLVTTRKLS

HMMPfam: PF00931
IPR002182
1-174 NB-ARC,NBS
NB-ARC

GPGGSGKTTLARLVYHDPEVKDKFDIMLWIYVSANFDEVKLTQGILEQIPECEFKSAKNLTVLQRGINKYLTKRFLLVLDDMWEESEGRWDKLLAPLRSAQAKGNVLLVTTRKLSVARITSNTEAHIDLDGMKKDDFWLFFKRCIFGDENYQGQRKLQNIAKKIATRLNGNPFA

superfamily: SSF52540
1-165 SSF52540

GPGGSGKTTLARLVYHDPEVKDKFDIMLWIYVSANFDEVKLTQGILEQIPECEFKSAKNLTVLQRGINKYLTKRFLLVLDDMWEESEGRWDKLLAPLRSAQAKGNVLLVTTRKLSVARITSNTEAHIDLDGMKKDDFWLFFKRCIFGDENYQGQRKLQNIAKKIA

HMMPanther: PTHR11017:SF28
1-175 PTHR11017:SF28

GPGGSGKTTLARLVYHDPEVKDKFDIMLWIYVSANFDEVKLTQGILEQIPECEFKSAKNLTVLQRGINKYLTKRFLLVLDDMWEESEGRWDKLLAPLRSAQAKGNVLLVTTRKLSVARITSNTEAHIDLDGMKKDDFWLFFKRCIFGDENYQGQRKLQNIAKKIATRLNGNPFAA

HMMPanther: PTHR11017
1-175 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GPGGSGKTTLARLVYHDPEVKDKFDIMLWIYVSANFDEVKLTQGILEQIPECEFKSAKNLTVLQRGINKYLTKRFLLVLDDMWEESEGRWDKLLAPLRSAQAKGNVLLVTTRKLSVARITSNTEAHIDLDGMKKDDFWLFFKRCIFGDENYQGQRKLQNIAKKIATRLNGNPFAA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox