PRGDB00050746 (R 11)

From PRG Wiki
Revision as of 17:59, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
R 11
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 27764534 (AF541963)
Gene Class Unknown
Domain Type
Gene Species Glycine max

Comment?

Glycine max cv Williams 82 BAC clone Gm_ISb001_091_F11, complete sequence.

DNA Sequence

ATGAGTTCGAGAGGAGCGACCGCGGTGCTATCTCGTGCCAGCAGGATTCGGTCGAAGCTGCAAACGGCGCTGGAAGCCACCGTTTTGGAGGTGGACGACGTGTCGTACCAGCACGCGGGCCACGCCGCCGTGAAGGGTAGTTCCGACAAAGAAACCCACTTCAACCTCAACATCGTCTCCCCCAAGTTCGAGGGCCAGAGCCTTGTCAAACGACACCGTCTCATCTACGACCTCCTCGCCGACGAGCTCCAGAGCGGCCTCCACGCCCTCTCCATCGTCGCCAAAACTCCCCACGAAACAAACCCTTCTAAGTGA


Protein sequences

Name Description Sequence
unknown unknown [Glycine max].

MSSRGATAVLSRASRIRSKLQTALEATVLEVDDVSYQHAGHAAVKGSSDKETHFNLNIVSPKFEGQSLVKRHRLIYDLLADELQSGLHALSIVAKTPHETNPSK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR12735
IPR002634
3-101 BolA
BolA protein

SRGATAVLSRASRIRSKLQTALEATVLEVDDVSYQHAGHAAVKGSSDKETHFNLNIVSPKFEGQSLVKRHRLIYDLLADELQSGLHALSIVAKTPHETN

HMMPanther: PTHR12735:SF3
3-101 PTHR12735:SF3,BOLA-LIKE PROTEIN CGI-143

SRGATAVLSRASRIRSKLQTALEATVLEVDDVSYQHAGHAAVKGSSDKETHFNLNIVSPKFEGQSLVKRHRLIYDLLADELQSGLHALSIVAKTPHETN

HMMPIR: PIRSF003113
IPR002634
10-104 BolA
BolA protein

LSRASRIRSKLQTALEATVLEVDDVSYQHAGHAAVKGSSDKETHFNLNIVSPKFEGQSLVKRHRLIYDLLADELQSGLHALSIVAKTPHETNPSK

Gene3D: G3DSA:3.30.300.90
IPR002634
11-101 BolA
BolA protein

SRASRIRSKLQTALEATVLEVDDVSYQHAGHAAVKGSSDKETHFNLNIVSPKFEGQSLVKRHRLIYDLLADELQSGLHALSIVAKTPHETN

superfamily: SSF82657
IPR002634
11-104 BolA
BolA protein

SRASRIRSKLQTALEATVLEVDDVSYQHAGHAAVKGSSDKETHFNLNIVSPKFEGQSLVKRHRLIYDLLADELQSGLHALSIVAKTPHETNPSK

HMMPfam: PF01722
IPR002634
19-99 BolA
BolA protein

KLQTALEATVLEVDDVSYQHAGHAAVKGSSDKETHFNLNIVSPKFEGQSLVKRHRLIYDLLADELQSGLHALSIVAKTPHE


List of References

Michelle A Graham, Laura Fredrick Marek, Randy C Shoemaker
Organization, expression and evolution of a disease resistance gene cluster in soybean.
Genetics: 2002, 162(4);1961-77
PubMed:12524363 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox