PRGDB00050755 (R 11)

From PRG Wiki
Revision as of 18:00, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
R 11
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 27764534 (AF541963)
Gene Class T
Domain Type TIR, LRR
Gene Species Glycine max

Comment?

Glycine max cv Williams 82 BAC clone Gm_ISb001_091_F11, complete sequence.

DNA Sequence

ATGGCTGCAACAACAAGTTCCCGTGCATCCATCTACGATGTGTTCCTCAACTTCAGAGGGGAAGACACACGCTATGGTTTCACCAGCAATCTCTACAGGGCTCTTTCTGACAAGGGAATTCGTACCTTCTTTGACGAAGAGAAGCTTCACAGCGGAGAGGAAATAACACCTGCACTTTTGAAGGCAATTAAAGATTCCAGAATTGCCATCACTGTGCTCTCTGAAGACTTTGCTTCTTCCTCATTTTGCTTAGATGAACTTACATCCATTGTTCACTGCGCCCAGTATAATGGGATGATGATTATACCAGTGTTTTATAAGGTGTATCCTTCTGATGTCAGACACCAGAAGGGTACTTATGGAGAAGCATTGGCTAAGCATAAGATAAGATTTCCAGAAAAGTTCCAGAATTGGGAGATGGCTCTGCGTCAAGTTGCTGACTTGTCTGGCTTTCATTTCAAATACAGAGATGAATATGAGTACAAGTTTATTGAGAGAATTGTTGCGTCGGTCTCTGAGAAGATTAATCCTGCTAGAGTACATGTTGCCGATCTGCCTGTTGAACAAGAGTCCAAAGTGCAAGGAACTCATCAAGAGCAAGAATACAGAGAGGCTTTCAAGGTGTTTGACAAGGATCAAAATGGCTACATTTCAGCAAGTGAGTTGAGGCAAGTTCTGATCAAACTGGGTGAAAACACAACTGCTGGAGAGGTGGAGGAGATGATTGCAACTGCAGATTTGGATGGTGATGGTCAAATTAGCTATGAGGAATTTGTTAAGACTATGAAAATTTAA


Protein sequences

Name Description Sequence
R 9 protein R 9 protein [Glycine max].

MAATTSSRASIYDVFLNFRGEDTRYGFTSNLYRALSDKGIRTFFDEEKLHSGEEITPALLKAIKDSRIAITVLSEDFASSSFCLDELTSIVHCAQYNGMMIIPVFYKVYPSDVRHQKGTYGEALAKHKIRFPEKFQNWEMALRQVADLSGFHFKYRDEYEYKFIERIVASVSEKINPARVHVADLPVEQESKVQGTHQEQEYREAFKVFDKDQNGYISASELRQVLIKLGENTTAGEVEEMIATADLDGDGQISYEEFVKTMKI

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-151 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MAATTSSRASIYDVFLNFRGEDTRYGFTSNLYRALSDKGIRTFFDEEKLHSGEEITPALLKAIKDSRIAITVLSEDFASSSFCLDELTSIVHCAQYNGMMIIPVFYKVYPSDVRHQKGTYGEALAKHKIRFPEKFQNWEMALRQVADLSGF

Gene3D: G3DSA:3.40.50.10140
9-145 G3DSA:3.40.50.10140

ASIYDVFLNFRGEDTRYGFTSNLYRALSDKGIRTFFDEEKLHSGEEITPALLKAIKDSRIAITVLSEDFASSSFCLDELTSIVHCAQYNGMMIIPVFYKVYPSDVRHQKGTYGEALAKHKIRFPEKFQNWEMALRQV

ProfileScan: PS50104
IPR000157
10-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SIYDVFLNFRGEDTRYGFTSNLYRALSDKGIRTFFDEEKLHSGEEITPALLKAIKDSRIAITVLSEDFASSSFCLDELTSIVHCAQYNGMMIIPVFYKVYPSDVRHQKGTYGEALAKHKIRFPEKFQNWEMALRQVADL

HMMSmart: SM00255
IPR000157
11-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

IYDVFLNFRGEDTRYGFTSNLYRALSDKGIRTFFDEEKLHSGEEITPALLKAIKDSRIAITVLSEDFASSSFCLDELTSIVHCAQYNGMMIIPVFYKVYPSDVRHQKGTYGEALAKHKIRFPEKFQNWEMALRQVADL

HMMPfam: PF01582
IPR000157
14-142 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLNFRGEDTRYGFTSNLYRALSDKGIRTFFDEEKLHSGEEITPALLKAIKDSRIAITVLSEDFASSSFCLDELTSIVHCAQYNGMMIIPVFYKVYPSDVRHQKGTYGEALAKHKIRFPEKFQNWEMAL

HMMPanther: PTHR23050:SF20
192-262 PTHR23050:SF20,CALMODULIN

KVQGTHQEQEYREAFKVFDKDQNGYISASELRQVLIKLGENTTAGEVEEMIATADLDGDGQISYEEFVKTM

HMMPanther: PTHR23050
192-262 PTHR23050,CALCIUM BINDING PROTEIN

KVQGTHQEQEYREAFKVFDKDQNGYISASELRQVLIKLGENTTAGEVEEMIATADLDGDGQISYEEFVKTM

Gene3D: G3DSA:1.10.238.10
IPR011992
194-263 EF-Hand_type
EF-hand-like domain

QGTHQEQEYREAFKVFDKDQNGYISASELRQVLIKLGENTTAGEVEEMIATADLDGDGQISYEEFVKTMK

superfamily: SSF47473
194-263 SSF47473

QGTHQEQEYREAFKVFDKDQNGYISASELRQVLIKLGENTTAGEVEEMIATADLDGDGQISYEEFVKTMK

ProfileScan: PS50222
IPR018249
197-232 EF_HAND_2
EF-HAND 2

HQEQEYREAFKVFDKDQNGYISASELRQVLIKLGEN

HMMSmart: SM00054
IPR002048
201-229 EFh
Calcium-binding EF-hand

EYREAFKVFDKDQNGYISASELRQVLIKL

HMMPfam: PF13499
202-260 EF_hand_5,EF-hand domain pair

YREAFKVFDKDQNGYISASELRQVLIKLGENTTAGEVEEMIATADLDGDGQISYEEFVK

PatternScan: PS00018
IPR018247
210-222 EF_HAND_1
EF-Hand 1, calcium-binding site

DKDQNGYISASEL

ProfileScan: PS50222
IPR018249
233-264 EF_HAND_2
EF-HAND 2

TTAGEVEEMIATADLDGDGQISYEEFVKTMKI

HMMSmart: SM00054
IPR002048
237-264 EFh
Calcium-binding EF-hand

EVEEMIATADLDGDGQISYEEFVKTMKI

PatternScan: PS00018
IPR018247
246-258 EF_HAND_1
EF-Hand 1, calcium-binding site

DLDGDGQISYEEF


List of References

Michelle A Graham, Laura Fredrick Marek, Randy C Shoemaker
Organization, expression and evolution of a disease resistance gene cluster in soybean.
Genetics: 2002, 162(4);1961-77
PubMed:12524363 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox