PRGDB00050884 (YK12)

From PRG Wiki
Revision as of 18:10, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
YK12
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 7243643 (AF230500)
Gene Class Unknown
Domain Type
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa subsp. japonica serine/threonine protein kinase (YK12) gene, partial cds.

DNA Sequence

ATGCCGTAGGAGTAGATGTCGGAGCAGGTGGTGAGCTTGCCGGTGAGAGCGTACTCGGGGGCGCAGTAGCCGTAGGTGCCCATGACGCGGGTGGAGACGTGGGTCTTGTCGCCGACGGGGCCGACCTTGGCGAGGCCGAAGTCGGAGAGGCGGGCCTGGAAGGAGGAGTCGAGGAGGATGTTGGAGGCCTTGAAGTCGCGGTAGATGACGGGGGGACGAGCTGCGTCGTGCAGGTGCTCAAGGCCGCGGGCGGCGCCCTGCGCGATGCGCATCCGAGTGGTCCAGTCCAGAGCCGCGGCGCCAGGGGGCAGGTCAAGCAGGTGGTCCTCCAGGGAGCCGCGGGCCATGTACTCGTACACCAGGATGCGGTGGTCGCCGTCGGTGCAGTACCCCAGCAGCGTCACCAGGTTTGGGTGCTCCGCCAGCAGGCTCAGCATCAGCACCTCCACAAGGAACTCCCGGTTCCCCTGCATCCCGTTCCGGTCCAGCTGCTTTACCGCCGCCTCCGTCACC


Protein sequences

Name Description Sequence
serine/threonine protein kinase serine/threonine protein kinase [Oryza sativa (japonica cultivar-group)].

AVGVDVGAGGELAGESVLGGAVAVGAHDAGGDVGLVADGADLGEAEVGEAGLEGGVEEDVGGLEVAVDDGGTSCVVQVLKAAGGALRDAHPSGPVQSRGARGQVKQVVLQGAAGHVLVHQDAVVAVGAVPQQRHQVWVLRQQAQHQHLHKELPVPLHPVPVQLLYRRLRH







List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox