PRGDB00050917 (putative Pto-like serine/threonine kinase)

From PRG Wiki
Revision as of 18:13, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
putative Pto-like serine/threonine kinase
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 15054744 (AF288547)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Solanum sucrense

Comment?

Solanum sucrense scr1A putative Pto-like serine/threonine kinase gene, partial cds.

DNA Sequence

TTTAAACTCGAGTTATCGCGTTCCTTTTGAAAGTTTTCGAGTTCCTTTTGTAGATTTGCAGGAAGCAACTAACAATTTCGATGAGAAGTTTCACATTGGATTGGGTGGCTTTGGGAAAGTTTACAGGGGTGTTTTGCGTGATGGAACAAAGGTGGCCTTGAAAAGGTATACACCTGAATCCAATCAAGGTCTTCAAGAGTTCCAAACAGAAATTGAGATTCTCTCTTTTTGCAGCCATCCGCATTTGGTTTCATTGATAGGATACTGTGATGAAAGAAATGAGATGATTCTAGTTTATGACTACATGGAGAATGGGAACCTCAGGAGCCATTTGTATGGCTCAGATCTACCCAGTATGAGCTGGGAGCAGAGGCTGGAGATATGCATCGGGGCAGCCAGAGGTCTGCATTATCTTCATACTAGCGCAGTTATACATCGTGATGTCAAGCCTATAAACATATTGCTTGATGAGAATTTTGTGGCAAAAATTACTGATTTTGGACTATCTAAGAAAAGGACTGAGCTTGATCAAACCCATCTTAGCACCCTTGTGCAAGGAACTCTAGGCTACCTTGACCCKGAATATTTTAATAGGGGACAACTGACAGAAAAATCKGATGTTTATTCTTTCGGTGTTGTTTTATTCGAAGTTCTTTGTGCTAGGCCTGCCATAGTTCAAACTCCTTCGAGGGGGATGATTAGTTTAGCTGAATGGGTAGTGGAGTCGCAGAAGAAGGGGCAATTGGAACAAATCATAGATCCCAATATTGTGGCCGAAATAAGACCAGAGTCCCTCAGGATATTTGGAGAAACAGCGGTGAAATGCTTAGCTTTGTCTGGTGAAGATAGGCCATCAATGGGTGATGTGTTG


Protein sequences

Name Description Sequence
putative Pto-like serine/threonine kinase putative Pto-like serine/threonine kinase [Solanum sucrense].

LNSSYRVPFESFRVPFVDLQEATNNFDEKFHIGLGGFGKVYRGVLRDGTKVALKRYTPESNQGLQEFQTEIEILSFCSHPHLVSLIGYCDERNEMILVYDYMENGNLRSHLYGSDLPSMSWEQRLEICIGAARGLHYLHTSAVIHRDVKPINILLDENFVAKITDFGLSKKRTELDQTHLSTLVQGTLGYLDPEYFNRGQLTEKSDVYSFGVVLFEVLCARPAIVQTPSRGMISLAEWVVESQKKGQLEQIIDPNIVAEIRPESLRIFGETAVKCLALSGEDRPSMGDVL

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
1-290 Kinase_like
Protein kinase-like domain

LNSSYRVPFESFRVPFVDLQEATNNFDEKFHIGLGGFGKVYRGVLRDGTKVALKRYTPESNQGLQEFQTEIEILSFCSHPHLVSLIGYCDERNEMILVYDYMENGNLRSHLYGSDLPSMSWEQRLEICIGAARGLHYLHTSAVIHRDVKPINILLDENFVAKITDFGLSKKRTELDQTHLSTLVQGTLGYLDPEYFNRGQLTEKSDVYSFGVVLFEVLCARPAIVQTPSRGMISLAEWVVESQKKGQLEQIIDPNIVAEIRPESLRIFGETAVKCLALSGEDRPSMGDVL

HMMPanther: PTHR24420:SF785
10-290 PTHR24420:SF785

ESFRVPFVDLQEATNNFDEKFHIGLGGFGKVYRGVLRDGTKVALKRYTPESNQGLQEFQTEIEILSFCSHPHLVSLIGYCDERNEMILVYDYMENGNLRSHLYGSDLPSMSWEQRLEICIGAARGLHYLHTSAVIHRDVKPINILLDENFVAKITDFGLSKKRTELDQTHLSTLVQGTLGYLDPEYFNRGQLTEKSDVYSFGVVLFEVLCARPAIVQTPSRGMISLAEWVVESQKKGQLEQIIDPNIVAEIRPESLRIFGETAVKCLALSGEDRPSMGDVL

HMMPanther: PTHR24420
10-290 PTHR24420,FAMILY NOT NAMED

ESFRVPFVDLQEATNNFDEKFHIGLGGFGKVYRGVLRDGTKVALKRYTPESNQGLQEFQTEIEILSFCSHPHLVSLIGYCDERNEMILVYDYMENGNLRSHLYGSDLPSMSWEQRLEICIGAARGLHYLHTSAVIHRDVKPINILLDENFVAKITDFGLSKKRTELDQTHLSTLVQGTLGYLDPEYFNRGQLTEKSDVYSFGVVLFEVLCARPAIVQTPSRGMISLAEWVVESQKKGQLEQIIDPNIVAEIRPESLRIFGETAVKCLALSGEDRPSMGDVL

Gene3D: G3DSA:3.30.200.20
14-102 G3DSA:3.30.200.20

VPFVDLQEATNNFDEKFHIGLGGFGKVYRGVLRDGTKVALKRYTPESNQGLQEFQTEIEILSFCSHPHLVSLIGYCDERNEMILVYDYM

ProfileScan: PS50011
IPR000719
26-290 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDEKFHIGLGGFGKVYRGVLRDGTKVALKRYTPESNQGLQEFQTEIEILSFCSHPHLVSLIGYCDERNEMILVYDYMENGNLRSHLYGSDLPSMSWEQRLEICIGAARGLHYLHTSAVIHRDVKPINILLDENFVAKITDFGLSKKRTELDQTHLSTLVQGTLGYLDPEYFNRGQLTEKSDVYSFGVVLFEVLCARPAIVQTPSRGMISLAEWVVESQKKGQLEQIIDPNIVAEIRPESLRIFGETAVKCLALSGEDRPSMGDVL

HMMPfam: PF07714
IPR001245
31-237 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

HIGLGGFGKVYRGVLRDGTKVALKRYTPESNQGLQEFQTEIEILSFCSHPHLVSLIGYCDERNEMILVYDYMENGNLRSHLYGSDLPSMSWEQRLEICIGAARGLHYLHTSAVIHRDVKPINILLDENFVAKITDFGLSKKRTELDQTHLSTLVQGTLGYLDPEYFNRGQLTEKSDVYSFGVVLFEVLCARPAIVQTPSRGMISLAE

PatternScan: PS00107
IPR017441
32-54 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGLGGFGKVYRGVLRDGTKVALK

Gene3D: G3DSA:1.10.510.10
104-290 G3DSA:1.10.510.10

NGNLRSHLYGSDLPSMSWEQRLEICIGAARGLHYLHTSAVIHRDVKPINILLDENFVAKITDFGLSKKRTELDQTHLSTLVQGTLGYLDPEYFNRGQLTEKSDVYSFGVVLFEVLCARPAIVQTPSRGMISLAEWVVESQKKGQLEQIIDPNIVAEIRPESLRIFGETAVKCLALSGEDRPSMGDVL

PatternScan: PS00108
IPR008271
143-155 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDVKPINILL


List of References

V G Vleeshouwers, A Martens, W van Dooijeweert, L T Colon, F Govers, S Kamoun
Ancient diversification of the Pto kinase family preceded speciation in Solanum.
Mol. Plant Microbe Interact.: 2001, 14(8);996-1005
PubMed:11497472 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox