PRGDB00050957 (PIB)

From PRG Wiki
Revision as of 22:32, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
PIB
Gene Type Reference_R-Genes,_manually_curated
GenBank 4689079 (AB013449)
Gene Class CNL
Domain Type LRR, NBS, Others
Chromosome 2
Gene Species Oryza sativa

Comment?

Oryza sativa Japonica Group mRNA for Pib, complete cds.

DNA Sequence

ATGGAGGCGACGGCGCTGAGTGTGGGCAAATCCGTGCTGAATGGAGCGCTTGGCTACGCAAAATCTGCATTTGCTGAGGAGGTGGCCTTGCAGCTTGGTATCCAGAAAGACCACACATTTGTTGCAGATGAGCTTGAGATGATGAGGTCTTTCATGATGGAGGCGCACGAGGAGCAAGATAACAGCAAGGTGGTCAAGACTTGGGTGAAGCAAGTCCGTGACACTGCCTATGATGTTGAGGACAGCCTCCAGGATTTCGCTGTTCATCTTAAGAGGCCATCCTGGTGGCGATTTCCTCGTACGCTGCTCGAGCGGCACCGTGTGGCCAAGCAGATGAAGGAGCTTAGGAACAAGGTCGAGGATGTCAGCCAGAGGAATGTGCGGTACCACCTCATCAAGGGCTCTGCCAAGGCCACCATCAATTCCACTGAGCAATCTAGCGTTATTGCTACAGCCATATTCGGCATTGACGATGCAAGGCGTGCCGCAAAGCAGGACAATCAGAGAGTGGATCTTGTCCAACTAATCAACAGTGAGGATCAGGACCTAAAAGTGATCGCGGTCTGGGGAACAAGTGGTGATATGGGCCAAACAACAATAATCAGGATGGCTTATGAGAACCCAGATGTCCAAATCAGATTCCCATGCCGTGCATGGGTAAGGGTGATGCATCCTTTCAGTCCAAGAGACTTTGTCCAGAGCTTGGTGAATCAGCTTCATGCAACCCAAGGGGTTGAAGCTCTGTTGGAGAAAGAGAAGACAGAACAAGATTTAGCTAAGAAATTCAATGGATGTGTGAATGATAGGAAGTGTCTAATTGTGCTTAATGACCTATCCACCATTGAAGAGTGGGACCAGATTAAGAAATGCTTCCAAAAATGCAGGAAAGGAAGCCGAATCATAGTGTCAAGCACTCAAGTTGAAGTTGCAAGCTTATGTGCTGGGCAAGAAAGCCAAGCCTCAGAGCTAAAGCAATTGTCTGCTGATCAGACCCTTTACGCATTCTACGACAAGGGTTCCCAAATTATAGAGGATTCAGTGAAGCCAGTGTCTATCTCGGATGTGGCCATCACAAGTACAAACAATCATACAGTGGCCCATGGTGAGATTATAGATGATCAATCAATGGATGCTGATGAGAAGAAGGTGGCTAGAAAGAGTCTTACTCGCATTAGGACAAGTGTTGGTGCTTCGGAGGAATCACAACTTATTGGGCGAGAGAAAGAAATATCTGAAATAACACACTTAATTTTAAACAATGATAGCCAGCAGGTTCAGGTGATCTCTGTGTGGGGAATGGGTGGCCTTGGAAAAACCACCCTAGTAAGCGGTGTTTATCAAAGCCCAAGGCTGAGTGATAAGTTTGACAAGTATGTTTTTGTCACAATCATGCGTCCTTTCATTCTTGTAGAGCTCCTTAGGAGTTTGGCTGAGCAACTACATAAAGGATCTTCTAAGAAGGAAGAACTGTTAGAAAATAGAGTCAGCAGTAAGAAATCACTAGCATCGATGGAGGATACCGAGTTGACTGGGCAGTTGAAAAGGCTTTTAGAAAAGAAAAGTTGCTTGATTGTTCTAGATGATTTCTCAGATACCTCAGAATGGGACCAGATAAAACCAACGTTATTCCCCCTGTTGGAAAAGACAAGCCGAATAATTGTGACTACAAGAAAAGAGAATATTGCCAACCATTGCTCAGGGAAAAATGGAAATGTGCACAACCTTAAAGTTCTTAAACATAATGATGCATTGTGCCTCTTGAGTGAGAAGGTATTTGAGGAGGCTACATATTTGGATGATCAGAACAATCCAGAGTTGGTTAAAGAAGCAAAACAAATCCTAAAGAAGTGCGATGGACTGCCCCTTGCAATAGTTGTCATAGGTGGATTCTTGGCAAACCGACCAAAGACCCCAGAAGAGTGGAGAAAATTGAACGAGAATATCAATGCTGAGTTGGAAATGAATCCAGAGCTTGGAATGATAAGAACCGTCCTTGAAAAAAGCTATGATGGTTTACCATACCATCTCAAGTCATGTTTTTTATATCTGTCCATTTTCCCTGAAGACCAGATCATTAGTCGAAGGCGTTTGGTGCATCGTTGGGCAGCAGAAGGTTACTCAACTGCAGCACATGGGAAATCTGCCATTGAAATAGCTAACGGCTACTTCATGGAACTCAAGAATAGAAGCATGATTTTACCATTCCAGCAATCAGGTAGCAGCAGGAAATCAATTGACTCTTGCAAAGTCCATGATCTCATGCGTGACATCGCCATCTCAAAGTCAACGGAGGAAAACCTTGTTTTTAGGGTGGAGGAAGGCTGCAGCGCGTACATACATGGTGCAATTCGTCATCTTGCTATAAGTAGCAACTGGAAGGGAGATAAGAGTGAATTCGAGGGCATAGTGGACCTGTCCCGAATACGATCGTTATCTCTGTTTGGGGATTGGAAGCCATTTTTTGTTTATGGCAAGATGAGGTTTATACGAGTGCTTGACTTTGAAGGGACTAGAGGTCTAGAATATCATCACCTTGATCAGATTTGGAAGCTTAATCACCTAAAATTCCTTTCTCTACGAGGATGCTATCGTATTGATCTACTGCCAGATTTACTGGGCAACCTGAGGCAACTCCAGATGCTAGACATCAGAGGTACATATGTAAAGGCTTTGCCAAAAACCATCATCAAGCTTCAGAAGCTACAGTACATTCATGCTGGGCGCAAAACAGACTATGTATGGGAGGAAAAGCATAGTTTAATGCAGAGGTGTCGTAAGGTGGGATGTATATGTGCAACATGTTGCCTCCCTCTTCTTTGCGAAATGTATGGCCCTCTCCATAAGGCCCTAGCCCGGCGTGATGCGTGGACTTTCGCTTGCTGCGTGAAATTCCCATCTATCATGACGGGAGTACATGAAGAGGAAGGCGCTATGGTGCCAAGTGGGATTAGAAAACTGAAAGACTTGCACACACTAAGGAACATAAATGTCGGAAGGGGAAATGCCATCCTACGAGATATCGGAATGCTCACAGGATTACACAAGTTAGGAGTGGCTGGCATCAACAAGAAGAATGGACGAGCGTTTCGCTTGGCCATTTCCAACCTCAACAAGCTGGAATCACTGTCTGTGAGTTCAGCAGGGATGCCGGGCTTGTGTGGTTGCTTGGATGATATATCCTCGCCTCCGGAAAACCTACAGAGCCTCAAGCTGTACGGCAGTTTGAAAACGTTGCCGGAATGGATCAAGGAGCTCCAGCATCTCGTGAAGTTAAAACTAGTGAGTACTAGGCTATTGGAGCACGACGTTGCTATGGAATTCCTTGGGGAACTACCGAAGGTGGAAATTCTAGTTATTTCACCGTTTAAGAGTGAAGAAATTCATTTCAAGCCTCCGCAGACTGGGACTGCTTTTGTAAGCCTCAGGGTGCTCAAGCTTGCAGGATTATGGGGCATCAAATCAGTGAAGTTTGAGGAAGGAACAATGCCCAAACTTGAGAGGCTGCAGGTCCAAGGGCGAATAGAAAATGAAATTGGCTTTTCTGGGTTAGAGTTTCTCCAAAACATCAACGAAGTCCAGCTCAGTGTTTGGTTTCCCACGGATCATGATAGGATAAGAGCCGCGCGCGCCGCGGGCGCTGATTATGAGACTGCCTGGGAGGAAGAGGTACAGGAAGCAAGGCGCAAGGGAGGTGAACTGAAGAGGAAAATCCGAGAACAGCTTGCTCGGAATCCAAACCAACCCATCATTACCTGA


Protein sequences

Name Description Sequence
Pib Pib [Oryza sativa Japonica Group].

MEATALSVGKSVLNGALGYAKSAFAEEVALQLGIQKDHTFVADELEMMRSFMMEAHEEQDNSKVVKTWVKQVRDTAYDVEDSLQDFAVHLKRPSWWRFPRTLLERHRVAKQMKELRNKVEDVSQRNVRYHLIKGSAKATINSTEQSSVIATAIFGIDDARRAAKQDNQRVDLVQLINSEDQDLKVIAVWGTSGDMGQTTIIRMAYENPDVQIRFPCRAWVRVMHPFSPRDFVQSLVNQLHATQGVEALLEKEKTEQDLAKKFNGCVNDRKCLIVLNDLSTIEEWDQIKKCFQKCRKGSRIIVSSTQVEVASLCAGQESQASELKQLSADQTLYAFYDKGSQIIEDSVKPVSISDVAITSTNNHTVAHGEIIDDQSMDADEKKVARKSLTRIRTSVGASEESQLIGREKEISEITHLILNNDSQQVQVISVWGMGGLGKTTLVSGVYQSPRLSDKFDKYVFVTIMRPFILVELLRSLAEQLHKGSSKKEELLENRVSSKKSLASMEDTELTGQLKRLLEKKSCLIVLDDFSDTSEWDQIKPTLFPLLEKTSRIIVTTRKENIANHCSGKNGNVHNLKVLKHNDALCLLSEKVFEEATYLDDQNNPELVKEAKQILKKCDGLPLAIVVIGGFLANRPKTPEEWRKLNENINAELEMNPELGMIRTVLEKSYDGLPYHLKSCFLYLSIFPEDQIISRRRLVHRWAAEGYSTAAHGKSAIEIANGYFMELKNRSMILPFQQSGSSRKSIDSCKVHDLMRDIAISKSTEENLVFRVEEGCSAYIHGAIRHLAISSNWKGDKSEFEGIVDLSRIRSLSLFGDWKPFFVYGKMRFIRVLDFEGTRGLEYHHLDQIWKLNHLKFLSLRGCYRIDLLPDLLGNLRQLQMLDIRGTYVKALPKTIIKLQKLQYIHAGRKTDYVWEEKHSLMQRCRKVGCICATCCLPLLCEMYGPLHKALARRDAWTFACCVKFPSIMTGVHEEEGAMVPSGIRKLKDLHTLRNINVGRGNAILRDIGMLTGLHKLGVAGINKKNGRAFRLAISNLNKLESLSVSSAGMPGLCGCLDDISSPPENLQSLKLYGSLKTLPEWIKELQHLVKLKLVSTRLLEHDVAMEFLGELPKVEILVISPFKSEEIHFKPPQTGTAFVSLRVLKLAGLWGIKSVKFEEGTMPKLERLQVQGRIENEIGFSGLEFLQNINEVQLSVWFPTDHDRIRAARAAGADYETAWEEEVQEARRKGGELKRKIREQLARNPNQPIIT

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
9-1195 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GKSVLNGALGYAKSAFAEEVALQLGIQKDHTFVADELEMMRSFMMEAHEEQDNSKVVKTWVKQVRDTAYDVEDSLQDFAVHLKRPSWWRFPRTLLERHRVAKQMKELRNKVEDVSQRNVRYHLIKGSAKATINSTEQSSVIATAIFGIDDARRAAKQDNQRVDLVQLINSEDQDLKVIAVWGTSGDMGQTTIIRMAYENPDVQIRFPCRAWVRVMHPFSPRDFVQSLVNQLHATQGVEALLEKEKTEQDLAKKFNGCVNDRKCLIVLNDLSTIEEWDQIKKCFQKCRKGSRIIVSSTQVEVASLCAGQESQASELKQLSADQTLYAFYDKGSQIIEDSVKPVSISDVAITSTNNHTVAHGEIIDDQSMDADEKKVARKSLTRIRTSVGASEESQLIGREKEISEITHLILNNDSQQVQVISVWGMGGLGKTTLVSGVYQSPRLSDKFDKYVFVTIMRPFILVELLRSLAEQLHKGSSKKEELLENRVSSKKSLASMEDTELTGQLKRLLEKKSCLIVLDDFSDTSEWDQIKPTLFPLLEKTSRIIVTTRKENIANHCSGKNGNVHNLKVLKHNDALCLLSEKVFEEATYLDDQNNPELVKEAKQILKKCDGLPLAIVVIGGFLANRPKTPEEWRKLNENINAELEMNPELGMIRTVLEKSYDGLPYHLKSCFLYLSIFPEDQIISRRRLVHRWAAEGYSTAAHGKSAIEIANGYFMELKNRSMILPFQQSGSSRKSIDSCKVHDLMRDIAISKSTEENLVFRVEEGCSAYIHGAIRHLAISSNWKGDKSEFEGIVDLSRIRSLSLFGDWKPFFVYGKMRFIRVLDFEGTRGLEYHHLDQIWKLNHLKFLSLRGCYRIDLLPDLLGNLRQLQMLDIRGTYVKALPKTIIKLQKLQYIHAGRKTDYVWEEKHSLMQRCRKVGCICATCCLPLLCEMYGPLHKALARRDAWTFACCVKFPSIMTGVHEEEGAMVPSGIRKLKDLHTLRNINVGRGNAILRDIGMLTGLHKLGVAGINKKNGRAFRLAISNLNKLESLSVSSAGMPGLCGCLDDISSPPENLQSLKLYGSLKTLPEWIKELQHLVKLKLVSTRLLEHDVAMEFLGELPKVEILVISPFKSEEIHFKPPQTGTAFVSLRVLKLAGLWGIKSVKFEEGTMPKLERLQVQGRIENEIGFSGLEFLQNINEVQLS

HMMPanther: PTHR23155:SF179
9-1195 OS08G0539400 PROTEIN,OS08G0539400 PROTEIN

GKSVLNGALGYAKSAFAEEVALQLGIQKDHTFVADELEMMRSFMMEAHEEQDNSKVVKTWVKQVRDTAYDVEDSLQDFAVHLKRPSWWRFPRTLLERHRVAKQMKELRNKVEDVSQRNVRYHLIKGSAKATINSTEQSSVIATAIFGIDDARRAAKQDNQRVDLVQLINSEDQDLKVIAVWGTSGDMGQTTIIRMAYENPDVQIRFPCRAWVRVMHPFSPRDFVQSLVNQLHATQGVEALLEKEKTEQDLAKKFNGCVNDRKCLIVLNDLSTIEEWDQIKKCFQKCRKGSRIIVSSTQVEVASLCAGQESQASELKQLSADQTLYAFYDKGSQIIEDSVKPVSISDVAITSTNNHTVAHGEIIDDQSMDADEKKVARKSLTRIRTSVGASEESQLIGREKEISEITHLILNNDSQQVQVISVWGMGGLGKTTLVSGVYQSPRLSDKFDKYVFVTIMRPFILVELLRSLAEQLHKGSSKKEELLENRVSSKKSLASMEDTELTGQLKRLLEKKSCLIVLDDFSDTSEWDQIKPTLFPLLEKTSRIIVTTRKENIANHCSGKNGNVHNLKVLKHNDALCLLSEKVFEEATYLDDQNNPELVKEAKQILKKCDGLPLAIVVIGGFLANRPKTPEEWRKLNENINAELEMNPELGMIRTVLEKSYDGLPYHLKSCFLYLSIFPEDQIISRRRLVHRWAAEGYSTAAHGKSAIEIANGYFMELKNRSMILPFQQSGSSRKSIDSCKVHDLMRDIAISKSTEENLVFRVEEGCSAYIHGAIRHLAISSNWKGDKSEFEGIVDLSRIRSLSLFGDWKPFFVYGKMRFIRVLDFEGTRGLEYHHLDQIWKLNHLKFLSLRGCYRIDLLPDLLGNLRQLQMLDIRGTYVKALPKTIIKLQKLQYIHAGRKTDYVWEEKHSLMQRCRKVGCICATCCLPLLCEMYGPLHKALARRDAWTFACCVKFPSIMTGVHEEEGAMVPSGIRKLKDLHTLRNINVGRGNAILRDIGMLTGLHKLGVAGINKKNGRAFRLAISNLNKLESLSVSSAGMPGLCGCLDDISSPPENLQSLKLYGSLKTLPEWIKELQHLVKLKLVSTRLLEHDVAMEFLGELPKVEILVISPFKSEEIHFKPPQTGTAFVSLRVLKLAGLWGIKSVKFEEGTMPKLERLQVQGRIENEIGFSGLEFLQNINEVQLS

Coil: coil
105-126 coiled-coil

RHRVAKQMKELRNKVEDVSQRN

superfamily: SSF52540
153-341 P-loop containing nucleoside triphosphate hydrolases

IFGIDDARRAAKQDNQRVDLVQLINSEDQDLKVIAVWGTSGDMGQTTIIRMAYENPDVQIRFPCRAWVRVMHPFSPRDFVQSLVNQLHATQGVEALLEKEKTEQDLAKKFNGCVNDRKCLIVLNDLSTIEEWDQIKKCFQKCRKGSRIIVSSTQVEVASLCAGQESQASELKQLSADQTLYAFYDKGSQ

HMMPfam: PF00931
IPR002182
174-335 NB-ARC,NBS
NB-ARC

QLINSEDQDLKVIAVWGTSGDMGQTTIIRMAYENPDVQIRFPCRAWVRVMHPFSPRDFVQSLVNQLHATQGVEALLEKEKTEQDLAKKFNGCVNDRKCLIVLNDLSTIEEWDQIKKCFQKCRKGSRIIVSSTQVEVASLCAGQESQASELKQLSADQTLYAF

Gene3D: G3DSA:3.40.50.300
401-549 no description

SQLIGREKEISEITHLILNNDSQQVQVISVWGMGGLGKTTLVSGVYQSPRLSDKFDKYVFVTIMRPFILVELLRSLAEQLHKGSSKKEELLENRVSSKKSLASMEDTELTGQLKRLLEKKSCLIVLDDFSDTSEWDQIKPTLFPLLEKT

superfamily: SSF52540
401-648 P-loop containing nucleoside triphosphate hydrolases

SQLIGREKEISEITHLILNNDSQQVQVISVWGMGGLGKTTLVSGVYQSPRLSDKFDKYVFVTIMRPFILVELLRSLAEQLHKGSSKKEELLENRVSSKKSLASMEDTELTGQLKRLLEKKSCLIVLDDFSDTSEWDQIKPTLFPLLEKTSRIIVTTRKENIANHCSGKNGNVHNLKVLKHNDALCLLSEKVFEEATYLDDQNNPELVKEAKQILKKCDGLPLAIVVIGGFLANRPKTPEEWRKLNENI

HMMPfam: PF00931
IPR002182
407-709 NB-ARC,NBS
NB-ARC

EKEISEITHLILNNDSQQVQVISVWGMGGLGKTTLVSGVYQSPRLSDKFDKYVFVTIMRPFILVELLRSLAEQLHKGSSKKEELLENRVSSKKSLASMEDTELTGQLKRLLEKKSCLIVLDDFSDTSEWDQIKPTLFPLLEKTSRIIVTTRKENIANHCSGKNGNVHNLKVLKHNDALCLLSEKVFEEATYLDDQNNPELVKEAKQILKKCDGLPLAIVVIGGFLANRPKTPEEWRKLNENINAELEMNPELGMIRTVLEKSYDGLPYHLKSCFLYLSIFPEDQIISRRRLVHRWAAEGYSTA

FPrintScan: PR00364
IPR000767
427-442 DISEASERSIST
Disease resistance protein

VISVWGMGGLGKTTLV

Coil: coil
473-494 coiled-coil

LRSLAEQLHKGSSKKEELLENR

FPrintScan: PR00364
IPR000767
516-530 DISEASERSIST
Disease resistance protein

LLEKKSCLIVLDDFS

FPrintScan: PR00364
IPR000767
617-631 DISEASERSIST
Disease resistance protein

CDGLPLAIVVIGGFL

superfamily: SSF52058
749-1195 L domain-like,LRR

KVHDLMRDIAISKSTEENLVFRVEEGCSAYIHGAIRHLAISSNWKGDKSEFEGIVDLSRIRSLSLFGDWKPFFVYGKMRFIRVLDFEGTRGLEYHHLDQIWKLNHLKFLSLRGCYRIDLLPDLLGNLRQLQMLDIRGTYVKALPKTIIKLQKLQYIHAGRKTDYVWEEKHSLMQRCRKVGCICATCCLPLLCEMYGPLHKALARRDAWTFACCVKFPSIMTGVHEEEGAMVPSGIRKLKDLHTLRNINVGRGNAILRDIGMLTGLHKLGVAGINKKNGRAFRLAISNLNKLESLSVSSAGMPGLCGCLDDISSPPENLQSLKLYGSLKTLPEWIKELQHLVKLKLVSTRLLEHDVAMEFLGELPKVEILVISPFKSEEIHFKPPQTGTAFVSLRVLKLAGLWGIKSVKFEEGTMPKLERLQVQGRIENEIGFSGLEFLQNINEVQLS

FPrintScan: PR00364
IPR000767
849-865 DISEASERSIST
Disease resistance protein

WKLNHLKFLSLRGCYRI

Gene3D: G3DSA:3.80.10.10
975-1038 no description

EGAMVPSGIRKLKDLHTLRNINVGRGNAILRDIGMLTGLHKLGVAGINKKNGRAFRLAISNLNK

Gene3D: G3DSA:3.80.10.10
1039-1190 no description

LESLSVSSAGMPGLCGCLDDISSPPENLQSLKLYGSLKTLPEWIKELQHLVKLKLVSTRLLEHDVAMEFLGELPKVEILVISPFKSEEIHFKPPQTGTAFVSLRVLKLAGLWGIKSVKFEEGTMPKLERLQVQGRIENEIGFSGLEFLQNIN

Seg: seg
1204-1213 seg

RIRAARAAGA

Coil: coil
1223-1244 coiled-coil

VQEARRKGGELKRKIREQLARN


Diseases

Disease Pathogen Avirulence gene
Rice blast disease

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox