PRGDB00050960 (RPP4)

From PRG Wiki
Revision as of 22:32, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
RPP4
Gene Type Reference_R-Genes,_manually_curated
GenBank 42566890 (NM_117790)
Gene Class TNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, TIR, Others
Chromosome 4
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana RPP4 (RECOGNITION OF PERONOSPORA PARASITICA 4) (RPP4) mRNA, complete cds.

DNA Sequence

ATGGCTTCTTCTTCTTCTTCTCCTAGTAGCCGGAGATACGACGTTTTCCCAAGCTTCAGTGGGGTAGATGTTCGCAAAACGTTCCTCAGCCATCTAATCGAGGCGCTCGACCGCAGATCAATCAATACATTCATGGATCACGGCATCGTGAGAAGCTGCATAATCGCCGATGCGCTTATAACGGCCATTAGAGAAGCGAGGATCTCAATAGTCATCTTCTCTGAGAACTATGCTTCTTCAACGTGGTGCTTGAATGAATTGGTGGAGATCCACAAGTGTTACAAGAAAGGGGAACAAATGGTGATTCCGGTTTTCTACGGCGTTGATCCTTCTCATGTTAGAAAACAGATCGGTGGCTTTGGCGATGTCTTTAAAAAGACATGCGAGGACAAACCAGAGGATCAGAAACAAAGATGGGTTAAAGCTCTCACAGATATATCAAATTTAGCCGGGGAGGATCTTCGGAACGGGCCTACTGAAGCGTTTATGGTTAAAAAGATAGCCAATGATGTTTCGAATAAACTTTTTCCTCTGCCAAAGGGTTTTGGTGACTTCGTCGGAATTGAAGATCATATAAAGGCAATAAAATCAATACTTTGCTTGGAATCCAAGGAAGCTAGAATAATGGTCGGGATTTGGGGACAGTCAGGGATTGGTAAGAGTACCATAGGAAGAGCTCTTTTCAGTCAACTCTCTAGCCAGTTCCACCATCGCGCTTTCATAACTTATAAAAGCACCAGTGGTAGTGACGTCTCTGGCATGAAGTTGAGTTGGGAAAAAGAACTTCTCTCGGAAATCTTAGGTCAAAAGGACATAAAGATAGATCATTTTGGTGTGGTGGAGCAAAGGTTAAAGCACAAGAAAGTTCTTATCCTTCTTGATGATGTGGATAATCTAGAGTTTCTTAAGACCTTGGTGGGAAAAGCTGAATGGTTTGGTTCTGGAAGCAGAATAATTGTGATCACTCAAGATAAGCAACTTCTCAAGGCTCATGAGATTGACCTTGTATATGAGGTGGAGCTGCCATCTCAAGGTCTTGCTCTTAAGATGATATCCCAATATGCTTTTGGGAAAGACTCTCCACCTGATGATTTTAAGGAACTAGCATTTGAAGTTGCCGAGCTTGTCGGTAGTCTTCCTTTGGGTCTCAGTGTCTTGGGTTCATCTTTAAAAGGAAGGGACAAAGATGAGTGGGTGAAGATGATGCCTAGGCTTCGAAATGATTCAGATGATAAAATTGAGGAAACACTAAGAGTCGGCTACGATAGGTTAAATAAAAAAAATAGAGAGTTATTTAAGTGCATTGCATGTTTTTTCAATGGTTTTAAAGTCAGTAACGTCAAAGAATTACTTGAAGATGATGTTGGGCTTACAATGTTGGCTGATAAGTCCCTCATACGTATTACACCGGATGGAGATATAGAGATGCACAATTTGCTAGAGAAATTGGGTAGAGAAATTGATCGTGCAAAGTCCAAGGGTAATCCTGCAAAACGTCAATTTCTGACGAATTTTGAGGATATTCAAGAAGTAGTGACCGAGAAAACTGGGACAGAAACTGTTCTTGGAATACGTGTGCCACCCACGGTATTATTTTCGACAAGGCCGTTATTAGTAATAAACGAAGAATCGTTCAAAGGCATGCGTAATCTCCAATATCTAGAAATTGGTCATTGGTCAGAAATTGGTCTTTGGTCAGAAATTGGTCTTTGGTCAAAAATAGATCTACCTCAGGGCCTCGTTTATTTGCCCCTTAAACTCAAATTGCTAAAATGGAATTATTGTCCATTGAAGTCTTTGCCATCTACTTTTAAGGCGGAATATCTAGTTAACCTCATAATGAAGTATAGTAAGCTTGAGAAACTGTGGGAAGGAACTCTGCCCCTTGGAAGTCTCAAGAAGATGGATTTGGGGTGTTCCAACAATTTGAAAGAAATTCCAGATCTTTCTTTAGCCATAAACCTCGAGGAATTAAATCTTTCTAAATGCGAATCTTTGGTGACACTTCCTTCCTCGATTCAGAATGCCATTAAACTGAGGACGTTATATTGTTCGGGGGTGCTATTAATAGATTTAAAATCATTAGAAGGCATGTGTAATCTCGAATATCTATCAGTTGATTGGTCAAGTATGGAAGGCACTCAAGGCCTCATTTACTTGCCACGTAAACTCAAAAGGCTATGGTGGGATTATTGTCCAGTGAAGCGTTTGCCTTCTAATTTTAAGGCTGAGTATCTAGTTGAACTCAGAATGGAGAATAGTGACCTTGAGAAGCTGTGGGATGGAACTCAGCCACTTGGAAGCCTCAAGGAGATGTATCTGCATGGTTCCAAATATTTGAAAGAAATTCCAGATCTTTCTTTAGCCATAAACCTGGAGAGACTATATCTTTTTGGATGCGAATCTTTGGTGACACTTCCTTCCTCGATTCAGAATGCCACTAAATTGATCAATTTAGATATGAGAGATTGCAAAAAGCTAGAGAGTTTTCCAACCGATCTCAACTTGGAATCTCTCGAGTACCTCAATCTCACTGGATGCCCGAATTTGAGAAATTTCCCAGCAATCAAAATGGGATGTTCATACTTTGAAATTCTGCAAGATAGAAATGAGATCGAGGTAGAAGATTGTTTCTGGAACAAGAATCTCCCTGCTGGACTAGATTATCTCGACTGCCTTATGAGGTGTATGCCTTGTGAATTTCGCCCAGAATATCTCACTTTTCTCGATGTGAGCGGCTGCAAGCATGAGAAGCTATGGGAAGGCATCCAGTCGCTTGGAAGTCTCAAGAGGATGGATCTGTCAGAATCTGAAAACCTGACAGAAATTCCAGATCTTTCGAAGGCCACCAATCTGAAGCGTTTATATCTCAACGGGTGCAAAAGTTTGGTGACACTTCCTTCTACAATTGGGAATCTTCATAGATTGGTGAGGTTGGAAATGAAAGAATGCACAGGGCTGGAGCTTCTTCCAACCGATGTCAACTTGTCATCTCTTATCATCCTCGATCTCAGTGGTTGCTCAAGTCTGAGAACTTTTCCTCTGATTTCAACTAGAATCGAATGTCTCTATCTAGAAAACACCGCCATTGAAGAAGTTCCCTGCTGCATTGAGGATTTAACGAGGCTCAGTGTACTACTGATGTATTGTTGCCAGAGGTTGAAAAACATCTCCCCAAACATTTTCAGACTGACAAGTCTAATGGTCGCCGACTTTACAGACTGTAGAGGTGTCATCAAGGCGTTGAGTGATGCAACTGTGGTAGCGACAATGGAAGATCATGTTTCTTGTGTACCATTATCTGAAAACATTGAATATACATGTGAACGTTTCTGGGATGAGTTGTATGAAAGAAATTCCAGATCTATCTTTAGCTATAAAGATGAGGATGGCGACGTATATTGGGTAAATTGGGACTTAATGATGATGCTGATGTTGATATAG


Protein sequences

Name Description Sequence
RPP4 (RECOGNITION OF PERONOSPORA PARASITICA 4) RPP4 (RECOGNITION OF PERONOSPORA PARASITICA 4) [Arabidopsis thaliana].

MASSSSSPSSRRYDVFPSFSGVDVRKTFLSHLIEALDRRSINTFMDHGIVRSCIIADALITAIREARISIVIFSENYASSTWCLNELVEIHKCYKKGEQMVIPVFYGVDPSHVRKQIGGFGDVFKKTCEDKPEDQKQRWVKALTDISNLAGEDLRNGPTEAFMVKKIANDVSNKLFPLPKGFGDFVGIEDHIKAIKSILCLESKEARIMVGIWGQSGIGKSTIGRALFSQLSSQFHHRAFITYKSTSGSDVSGMKLSWEKELLSEILGQKDIKIDHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDKQLLKAHEIDLVYEVELPSQGLALKMISQYAFGKDSPPDDFKELAFEVAELVGSLPLGLSVLGSSLKGRDKDEWVKMMPRLRNDSDDKIEETLRVGYDRLNKKNRELFKCIACFFNGFKVSNVKELLEDDVGLTMLADKSLIRITPDGDIEMHNLLEKLGREIDRAKSKGNPAKRQFLTNFEDIQEVVTEKTGTETVLGIRVPPTVLFSTRPLLVINEESFKGMRNLQYLEIGHWSEIGLWSEIGLWSKIDLPQGLVYLPLKLKLLKWNYCPLKSLPSTFKAEYLVNLIMKYSKLEKLWEGTLPLGSLKKMDLGCSNNLKEIPDLSLAINLEELNLSKCESLVTLPSSIQNAIKLRTLYCSGVLLIDLKSLEGMCNLEYLSVDWSSMEGTQGLIYLPRKLKRLWWDYCPVKRLPSNFKAEYLVELRMENSDLEKLWDGTQPLGSLKEMYLHGSKYLKEIPDLSLAINLERLYLFGCESLVTLPSSIQNATKLINLDMRDCKKLESFPTDLNLESLEYLNLTGCPNLRNFPAIKMGCSYFEILQDRNEIEVEDCFWNKNLPAGLDYLDCLMRCMPCEFRPEYLTFLDVSGCKHEKLWEGIQSLGSLKRMDLSESENLTEIPDLSKATNLKRLYLNGCKSLVTLPSTIGNLHRLVRLEMKECTGLELLPTDVNLSSLIILDLSGCSSLRTFPLISTRIECLYLENTAIEEVPCCIEDLTRLSVLLMYCCQRLKNISPNIFRLTSLMVADFTDCRGVIKALSDATVVATMEDHVSCVPLSENIEYTCERFWDELYERNSRSIFSYKDEDGDVYWVNWDLMMMLMLI

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MASSSSSPSSRRYDVFPSFSGVDVRKTFLSHLIEALDRRSINTFMDHGIVRSCIIADALITAIREARISIVIFSENYASSTWCLNELVEIHKCYKKGEQMVIPVFYGVDPSHVRKQIGGFGDVFKKTCEDKPEDQKQRWVKALTDISNLAGE

Gene3D: G3DSA:3.40.50.10140
10-143 G3DSA:3.40.50.10140

SRRYDVFPSFSGVDVRKTFLSHLIEALDRRSINTFMDHGIVRSCIIADALITAIREARISIVIFSENYASSTWCLNELVEIHKCYKKGEQMVIPVFYGVDPSHVRKQIGGFGDVFKKTCEDKPEDQKQRWVKAL

ProfileScan: PS50104
IPR000157
11-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RRYDVFPSFSGVDVRKTFLSHLIEALDRRSINTFMDHGIVRSCIIADALITAIREARISIVIFSENYASSTWCLNELVEIHKCYKKGEQMVIPVFYGVDPSHVRKQIGGFGDVFKKTCEDKPEDQKQRWVKALTDISNL

HMMSmart: SM00255
IPR000157
12-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RYDVFPSFSGVDVRKTFLSHLIEALDRRSINTFMDHGIVRSCIIADALITAIREARISIVIFSENYASSTWCLNELVEIHKCYKKGEQMVIPVFYGVDPSHVRKQIGGFGDVFKKTCEDKPEDQKQRWVKALTDISNL

HMMPfam: PF01582
IPR000157
15-144 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFSGVDVRKTFLSHLIEALDRRSINTFMDHGIVRSCIIADALITAIREARISIVIFSENYASSTWCLNELVEIHKCYKKGEQMVIPVFYGVDPSHVRKQIGGFGDVFKKTCEDKPEDQKQRWVKALT

HMMPanther: PTHR11017:SF20
34-1136 PTHR11017:SF20,SUBFAMILY NOT NAMED

EALDRRSINTFMDHGIVRSCIIADALITAIREARISIVIFSENYASSTWCLNELVEIHKCYKKGEQMVIPVFYGVDPSHVRKQIGGFGDVFKKTCEDKPEDQKQRWVKALTDISNLAGEDLRNGPTEAFMVKKIANDVSNKLFPLPKGFGDFVGIEDHIKAIKSILCLESKEARIMVGIWGQSGIGKSTIGRALFSQLSSQFHHRAFITYKSTSGSDVSGMKLSWEKELLSEILGQKDIKIDHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDKQLLKAHEIDLVYEVELPSQGLALKMISQYAFGKDSPPDDFKELAFEVAELVGSLPLGLSVLGSSLKGRDKDEWVKMMPRLRNDSDDKIEETLRVGYDRLNKKNRELFKCIACFFNGFKVSNVKELLEDDVGLTMLADKSLIRITPDGDIEMHNLLEKLGREIDRAKSKGNPAKRQFLTNFEDIQEVVTEKTGTETVLGIRVPPTVLFSTRPLLVINEESFKGMRNLQYLEIGHWSEIGLWSEIGLWSKIDLPQGLVYLPLKLKLLKWNYCPLKSLPSTFKAEYLVNLIMKYSKLEKLWEGTLPLGSLKKMDLGCSNNLKEIPDLSLAINLEELNLSKCESLVTLPSSIQNAIKLRTLYCSGVLLIDLKSLEGMCNLEYLSVDWSSMEGTQGLIYLPRKLKRLWWDYCPVKRLPSNFKAEYLVELRMENSDLEKLWDGTQPLGSLKEMYLHGSKYLKEIPDLSLAINLERLYLFGCESLVTLPSSIQNATKLINLDMRDCKKLESFPTDLNLESLEYLNLTGCPNLRNFPAIKMGCSYFEILQDRNEIEVEDCFWNKNLPAGLDYLDCLMRCMPCEFRPEYLTFLDVSGCKHEKLWEGIQSLGSLKRMDLSESENLTEIPDLSKATNLKRLYLNGCKSLVTLPSTIGNLHRLVRLEMKECTGLELLPTDVNLSSLIILDLSGCSSLRTFPLISTRIECLYLENTAIEEVPCCIEDLTRLSVLLMYCCQRLKNISPNIFRLTSLMVADFTDCRGVIKALSDATVVATMEDHVSCVPLSENIEYTCERFWDELYERNSRSIFSYKDEDGDVYWV

HMMPanther: PTHR11017
34-1136 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

EALDRRSINTFMDHGIVRSCIIADALITAIREARISIVIFSENYASSTWCLNELVEIHKCYKKGEQMVIPVFYGVDPSHVRKQIGGFGDVFKKTCEDKPEDQKQRWVKALTDISNLAGEDLRNGPTEAFMVKKIANDVSNKLFPLPKGFGDFVGIEDHIKAIKSILCLESKEARIMVGIWGQSGIGKSTIGRALFSQLSSQFHHRAFITYKSTSGSDVSGMKLSWEKELLSEILGQKDIKIDHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDKQLLKAHEIDLVYEVELPSQGLALKMISQYAFGKDSPPDDFKELAFEVAELVGSLPLGLSVLGSSLKGRDKDEWVKMMPRLRNDSDDKIEETLRVGYDRLNKKNRELFKCIACFFNGFKVSNVKELLEDDVGLTMLADKSLIRITPDGDIEMHNLLEKLGREIDRAKSKGNPAKRQFLTNFEDIQEVVTEKTGTETVLGIRVPPTVLFSTRPLLVINEESFKGMRNLQYLEIGHWSEIGLWSEIGLWSKIDLPQGLVYLPLKLKLLKWNYCPLKSLPSTFKAEYLVNLIMKYSKLEKLWEGTLPLGSLKKMDLGCSNNLKEIPDLSLAINLEELNLSKCESLVTLPSSIQNAIKLRTLYCSGVLLIDLKSLEGMCNLEYLSVDWSSMEGTQGLIYLPRKLKRLWWDYCPVKRLPSNFKAEYLVELRMENSDLEKLWDGTQPLGSLKEMYLHGSKYLKEIPDLSLAINLERLYLFGCESLVTLPSSIQNATKLINLDMRDCKKLESFPTDLNLESLEYLNLTGCPNLRNFPAIKMGCSYFEILQDRNEIEVEDCFWNKNLPAGLDYLDCLMRCMPCEFRPEYLTFLDVSGCKHEKLWEGIQSLGSLKRMDLSESENLTEIPDLSKATNLKRLYLNGCKSLVTLPSTIGNLHRLVRLEMKECTGLELLPTDVNLSSLIILDLSGCSSLRTFPLISTRIECLYLENTAIEEVPCCIEDLTRLSVLLMYCCQRLKNISPNIFRLTSLMVADFTDCRGVIKALSDATVVATMEDHVSCVPLSENIEYTCERFWDELYERNSRSIFSYKDEDGDVYWV

superfamily: SSF52540
168-413 SSF52540

ANDVSNKLFPLPKGFGDFVGIEDHIKAIKSILCLESKEARIMVGIWGQSGIGKSTIGRALFSQLSSQFHHRAFITYKSTSGSDVSGMKLSWEKELLSEILGQKDIKIDHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDKQLLKAHEIDLVYEVELPSQGLALKMISQYAFGKDSPPDDFKELAFEVAELVGSLPLGLSVLGSSLKGRDKDEWVKMMPRLRNDSDDKI

Gene3D: G3DSA:3.40.50.300
179-329 G3DSA:3.40.50.300

PKGFGDFVGIEDHIKAIKSILCLESKEARIMVGIWGQSGIGKSTIGRALFSQLSSQFHHRAFITYKSTSGSDVSGMKLSWEKELLSEILGQKDIKIDHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDKQLLK

HMMPfam: PF00931
IPR002182
189-446 NB-ARC,NBS
NB-ARC

EDHIKAIKSILCLESKEARIMVGIWGQSGIGKSTIGRALFSQLSSQFHHRAFITYKSTSGSDVSGMKLSWEKELLSEILGQKDIKIDHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDKQLLKAHEIDLVYEVELPSQGLALKMISQYAFGKDSPPDDFKELAFEVAELVGSLPLGLSVLGSSLKGRDKDEWVKMMPRLRNDSDDKIEETLRVGYDRLNKKNRELFKCIACFFNGFKVSN

HMMSmart: SM00382
IPR003593
206-343 AAA,NBS
AAA+ ATPase domain

ARIMVGIWGQSGIGKSTIGRALFSQLSSQFHHRAFITYKSTSGSDVSGMKLSWEKELLSEILGQKDIKIDHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDKQLLKAHEIDLVYEVELPS

FPrintScan: PR00364
IPR000767
209-224 DISEASERSIST
Disease resistance protein

MVGIWGQSGIGKSTIG

FPrintScan: PR00364
IPR000767
283-297 DISEASERSIST
Disease resistance protein

RLKHKKVLILLDDVD

FPrintScan: PR00364
IPR000767
376-390 DISEASERSIST
Disease resistance protein

VGSLPLGLSVLGSSL

superfamily: SSF46785
411-513 SSF46785

DKIEETLRVGYDRLNKKNRELFKCIACFFNGFKVSNVKELLEDDVGLTMLADKSLIRITPDGDIEMHNLLEKLGREIDRAKSKGNPAKRQFLTNFEDIQEVVT

superfamily: SSF52058
475-866 SSF52058,LRR

EMHNLLEKLGREIDRAKSKGNPAKRQFLTNFEDIQEVVTEKTGTETVLGIRVPPTVLFSTRPLLVINEESFKGMRNLQYLEIGHWSEIGLWSEIGLWSKIDLPQGLVYLPLKLKLLKWNYCPLKSLPSTFKAEYLVNLIMKYSKLEKLWEGTLPLGSLKKMDLGCSNNLKEIPDLSLAINLEELNLSKCESLVTLPSSIQNAIKLRTLYCSGVLLIDLKSLEGMCNLEYLSVDWSSMEGTQGLIYLPRKLKRLWWDYCPVKRLPSNFKAEYLVELRMENSDLEKLWDGTQPLGSLKEMYLHGSKYLKEIPDLSLAINLERLYLFGCESLVTLPSSIQNATKLINLDMRDCKKLESFPTDLNLESLEYLNLTGCPNLRNFPAIKMGCSYFEIL

Gene3D: G3DSA:3.80.10.10
540-702 G3DSA:3.80.10.10

INEESFKGMRNLQYLEIGHWSEIGLWSEIGLWSKIDLPQGLVYLPLKLKLLKWNYCPLKSLPSTFKAEYLVNLIMKYSKLEKLWEGTLPLGSLKKMDLGCSNNLKEIPDLSLAINLEELNLSKCESLVTLPSSIQNAIKLRTLYCSGVLLIDLKSLEGMCNLE

HMMPfam: PF07725
IPR011713
608-626 LRR_3
Leucine-rich repeat 3

YLVNLIMKYSKLEKLWEGT

HMMPfam: PF00560
IPR001611
654-675 LRR_1
Leucine-rich repeat

NLEELNLSKCESLVTLPSSIQN

Gene3D: G3DSA:3.80.10.10
703-866 G3DSA:3.80.10.10

YLSVDWSSMEGTQGLIYLPRKLKRLWWDYCPVKRLPSNFKAEYLVELRMENSDLEKLWDGTQPLGSLKEMYLHGSKYLKEIPDLSLAINLERLYLFGCESLVTLPSSIQNATKLINLDMRDCKKLESFPTDLNLESLEYLNLTGCPNLRNFPAIKMGCSYFEIL

HMMPfam: PF07725
IPR011713
745-764 LRR_3
Leucine-rich repeat 3

YLVELRMENSDLEKLWDGTQ

HMMPfam: PF00560
IPR001611
791-812 LRR_1
Leucine-rich repeat

NLERLYLFGCESLVTLPSSIQN

HMMPfam: PF00560
IPR001611
838-855 LRR_1
Leucine-rich repeat

SLEYLNLTGCPNLRNFPA

Gene3D: G3DSA:3.80.10.10
885-1074 G3DSA:3.80.10.10

AGLDYLDCLMRCMPCEFRPEYLTFLDVSGCKHEKLWEGIQSLGSLKRMDLSESENLTEIPDLSKATNLKRLYLNGCKSLVTLPSTIGNLHRLVRLEMKECTGLELLPTDVNLSSLIILDLSGCSSLRTFPLISTRIECLYLENTAIEEVPCCIEDLTRLSVLLMYCCQRLKNISPNIFRLTSLMVADFTD

superfamily: SSF52058
887-1077 SSF52058,LRR

LDYLDCLMRCMPCEFRPEYLTFLDVSGCKHEKLWEGIQSLGSLKRMDLSESENLTEIPDLSKATNLKRLYLNGCKSLVTLPSTIGNLHRLVRLEMKECTGLELLPTDVNLSSLIILDLSGCSSLRTFPLISTRIECLYLENTAIEEVPCCIEDLTRLSVLLMYCCQRLKNISPNIFRLTSLMVADFTDCRG

HMMPfam: PF00560
IPR001611
951-973 LRR_1
Leucine-rich repeat

NLKRLYLNGCKSLVTLPSTIGNL

FPrintScan: PR00364
IPR000767
994-1010 DISEASERSIST
Disease resistance protein

VNLSSLIILDLSGCSSL


Diseases

Disease Pathogen Avirulence gene
Downy mildew




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox