PRGDB00050962 (RPW8.2)

From PRG Wiki
Revision as of 22:32, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
RPW8.2
Gene Type Reference_R-Genes,_manually_curated
GenBank 12958161 (AF273059)
Gene Class Other
Domain Type RPW8, Others
Chromosome 3
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana RESISTANCE TO POWDERY MILDEW8 (RPW8) locus, complete cds.

DNA Sequence

GTACATGAGAGATATCAAAGAGTTCGAAGCTAAATTACGATGGGTGGTAGATGTGGATGTTCAAGTTAATCAATTGGCTGATATCAAAGAACTCAAGGCCAAGATGTCTGAAATCAGCACTAAACTTGACAAAATAATGCCTCAACCGAAGTTTGAAATCCACATCGGCTGGTGTTCAGGAAAAACAAACCGTGCGATCCGATTTACGTTCTGCAGTGATGATTCTTGAATGATTGCTGAGGTTGCCGCAGGGGGTGCTCTTGGACTTGCTCTCAGTGTCCTCCACGAGGCCGTCAAAAGAGCAAAAGATAGATCTGTAACCACAAGATTCATCTTACACCGTCTCGAAGCTACAATCGATAGTATCACACCGTTGGTGGTTCAAATTGATAAGTTCAGTGAAGAAATGGAAGATTCAACATCGAGGAAAGTCAATAAACGTCTTAAGCTTCTCCTTGAGAACGCTGTTTCTCTTGTTGAGGAGAATGCGGAGCTGAGACGCAGAAACGTACGCAAGAAGTTCAG


Protein sequences

Name Description Sequence
RPW8.2 RPW8.2 [Arabidopsis thaliana].

MIAEVAAGGALGLALSVLHEAVKRAKDRSVTTRFILHRLEATIDSITPLVVQIDKFSEEMEDSTSRKVNKRLKLLLENAVSLVEENAELRRRNVRKKFRYMRDIKEFEAKLRWVVDVDVQVNQLADIKELKAKMSEISTKLDKIMPQPKFEIHIGWCSGKTNRAIRFTFCSDDS

Domains

Domain Start-End Description Sequence

HMMPfam: PF05659
IPR008808
1-148 RPW8
Powdery mildew resistance protein, RPW8 domain

MIAEVAAGGALGLALSVLHEAVKRAKDRSVTTRFILHRLEATIDSITPLVVQIDKFSEEMEDSTSRKVNKRLKLLLENAVSLVEENAELRRRNVRKKFRYMRDIKEFEAKLRWVVDVDVQVNQLADIKELKAKMSEISTKLDKIMPQP

ProfileScan: PS51153
IPR008808
1-153 RPW8
Powdery mildew resistance protein, RPW8 domain

MIAEVAAGGALGLALSVLHEAVKRAKDRSVTTRFILHRLEATIDSITPLVVQIDKFSEEMEDSTSRKVNKRLKLLLENAVSLVEENAELRRRNVRKKFRYMRDIKEFEAKLRWVVDVDVQVNQLADIKELKAKMSEISTKLDKIMPQPKFEIH


Diseases

Disease Pathogen Avirulence gene
Powdery mildew Golovinomyces cichoracearum

List of References

S Xiao, S Ellwood, O Calis, E Patrick, T Li, M Coleman, J G Turner
Broad-spectrum mildew resistance in Arabidopsis thaliana mediated by RPW8.
Science: 2001, 291(5501);118-20
PubMed:11141561 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox