PRGDB00061434 (Mla12)

From PRG Wiki
Jump to: navigation, search
Mla12
Gene Type Reference_R-Genes,_manually_curated
GenBank 28565621 (AY196347)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Hordeum vulgare subsp. vulgare

Comment?

Hordeum vulgare subsp. vulgare MLA12 (Mla12) gene, complete cds.

DNA Sequence

ATGGATATTGTCACCGGTGCCATTTCCAACCTGATTCCCAAGTTGGGGGAGCTACTCACGGAGGAGTTCAAGCTGCACAAGGGTGTCAAGAAAAATATTGAGGACCTCGGGAAGGAGCTTGAGAGCATGAACGCTGCCCTCATCAAGATTGGTGAGGTGCCGAGGGAGCAGCTCGACAGCCAAGACAAGCTCTGGGCCGATGAGGTCAGAGAGCTCTCCTACGTCATTGAGGATGTCGTCGACAAGTTCCTCGTACAGGTTGATGGCATTAAGTCTGATGATAACAACAACAAATTTAAGGGGCTCATGAAGAGGACTACCGAGTTGTTGAAGAAAGTCAAGCATAAGCATGGGATAGCTCACGCGATCAAGGACATCCAAGAGCAACTCCAAAAGGTGGCTGATAGGCGTGACAGGAACAAGGTATTTGTTCCTCATCCTACGAGAACAATTGCTATTGACCCTTGCCTTCGAGCTTTGTATGCTGAAGCGACAGAGCTAGTTGGCATATATGGAAAGAGGGATCAAGGCCTCATGAGGTTGCTTTCCATGGAGGGCGATGATGCCTCTAATAAGAGACTGAAGAAGGTCTCCATTGTTGGATTTGGAGGGTTGGGCAAGACCACTCTTGCTAGAGCGGTATACGAGAAGATTAAAGGTGATTTCGATTGTCGGGCATTTGTTCCGGTCGGTCAGAACCCTGACATGAAGAAGGTTTTAAGGGATATCCTCATTGATCTCGGAAATCCTCACTCAGATCTTGCGATGCTGGATGCCAATCAGCTTATTAAAAAGCTTCATGAATTTCTAGAGAACAAAAGGTATCTTGTCATAATTGATGATATATGGGATGAAAAATTGTGGGAAGGCATCAACTTTGCTTTCTCCAATAGGAATAATCTAGGCAGTCGGCTAATCACCACAACCCGCATTGTCAGTGTCTCTAATTCATGTTGCTCATCAGATGGTGATTCAGTTTATCAAATGGAACCGCTTTCTGTTGATGACTCCAGAATGCTCTTCTACAAAAGAATATTTCCTGATGAGAATGCATGTATAAATGAATTTGAACAAGTATCCAGAGATATTCTAAAGAAATGTGGTGGGGTACCACTAGCCATAATTACTATAGCTAGTGCTTTGGCTGGTGACCAGAAGATGAAACCAAAATGTGAGTGGGATATTCTCCTTCGGTCCCTTGGCTCTGGACTAACAGAAGATAACAGTTTAGAGGAGATGCGGAGAATACTCTCTTTCAGCTATTCTAATCTACCTTCGAATCTGAAAACTTGTCTACTGTATCTATGTGTATATCCAGAAGATAGTATGATTTCTAGAGATAAACTGATATGGAAGTGGGTGGCCGAAGGATTTGTCCACCATGAAAATCAAGGAAATAGCCTGTATTTGCTCGGATTAAATTACTTCAACCAGCTCATTAATAGAAGTATGATCCAGCCAATATATAATTATAGCGGCGAGGCATATGCTTGCCGTGTACATGATATGGTTCTGGACCTTATCTGCAACTTGTCACGTGAAGCAAAGTTTGTGAATCTATTGGATGGCACTGGGAATAGCATGTCTTCACAGAGTAATTGTCGTCGTTTGTCCCTTCAGAAAAGAAATGAAGATCATCAAGCCAGGCCTCTCATAGATATCAAGAGTATGTCACGAGTGAGGTCAATTACTATCTTTCCACCTGCTATTGAAGTCATGCCATCTCTTTCAAGGTTTGAGGTTTTATGTGTACTTGATTTGTCGAAATGTAATCTTGGGGAGGATAGCAGCCTGCAACTTAACCTCAAGGATGTTGGACAATTAATTCAGCTAAGGTACCTTGGTCTAGAATGTACCAATATAAGTAAGCTCCCGACTGAGATAGGAAAACTGCAGTTTTTGGAGGTGTTGGATCTTGGAAACAATCCTAATCTAAAAGAATTGCCGTCCACTATTCGTAATTTCAGAAGATTAATCTACCTAAATTTAGTTGGCTGTCAGGTGATTCCTCCAGTGGGTGTGTTGCAAAATCTGACATCCATAGAAGTATTGAGGGGTATCTTGGTCTATCTGAACATTATTGCACAAGAGCTTGGCAACCTGGAAAGGGTGAGAGATCTTGAGATTCGCTTCAATGATGGTAGTTTGGATTTGTATGAAGGTTTGGTGAATTCTCTGTGCAACCTACATCACATCGAAAGTCTAAATATTCGTTGCAATCCCGGAGAAACATCATCTTTTGAACTGATGGATCTCTTGGAAGAACGTTGGGTGCCGCCTGTACATCTCCGTGAATTTAAGTCATTCATGCCCAGCCAACTCTCTGCACTGCGAGGGTGGATACAGAGAGACCCCTCCCATCTCTCGAACCTCTCCGAGTTAACCCTCTGGCCAGTGAAGGACGTGCAGCAGGATGACGTGGAAATCATTGGGGGGTTGTTGTCCCTTCGTCGTCTCTGGATAGTAAAGAGCATCCACCAAACGCAACGGCTGCTAGTCATCCGTGCAGATGGGTTCCGCTCTATGGTTGAATTTCGTTTGGATTGTGGATCTGCCACGCAGATATTGTTTGAGCCAGGAGCTTTGCCGAGGGCGGAATCAGTTGTGATCAGTCTGGGCGTGCGGGTGGCGAAAGAGGATGGTAACCGTGGCTTCGACTTGGGCCTGCAGGAAGCAAAGGATGTCTCCCTTCGGTGGGATGTCTTTGTTCTTCTCTATTGTGGTGGAGCGAGGGTTGGGGAGGCAAAGGAAGCGGAGGCTGCGGTGAGGCGTGCCCTGGAAGCTCATCCCAGACATCCTCGGATTTATATTGACATGAGGCCGGATATACAGGAAGGTGCTCATGATGACGATTTGTGTGAGAACGAGGACGAGGGTGAGAACTGA


Protein sequences

Name Description Sequence
MLA12 MLA12 [Hordeum vulgare subsp. vulgare].

MDIVTGAISNLIPKLGELLTEEFKLHKGVKKNIEDLGKELESMNAALIKIGEVPREQLDSQDKLWADEVRELSYVIEDVVDKFLVQVDGIKSDDNNNKFKGLMKRTTELLKKVKHKHGIAHAIKDIQEQLQKVADRRDRNKVFVPHPTRTIAIDPCLRALYAEATELVGIYGKRDQGLMRLLSMEGDDASNKRLKKVSIVGFGGLGKTTLARAVYEKIKGDFDCRAFVPVGQNPDMKKVLRDILIDLGNPHSDLAMLDANQLIKKLHEFLENKRYLVIIDDIWDEKLWEGINFAFSNRNNLGSRLITTTRIVSVSNSCCSSDGDSVYQMEPLSVDDSRMLFYKRIFPDENACINEFEQVSRDILKKCGGVPLAIITIASALAGDQKMKPKCEWDILLRSLGSGLTEDNSLEEMRRILSFSYSNLPSNLKTCLLYLCVYPEDSMISRDKLIWKWVAEGFVHHENQGNSLYLLGLNYFNQLINRSMIQPIYNYSGEAYACRVHDMVLDLICNLSREAKFVNLLDGTGNSMSSQSNCRRLSLQKRNEDHQARPLIDIKSMSRVRSITIFPPAIEVMPSLSRFEVLCVLDLSKCNLGEDSSLQLNLKDVGQLIQLRYLGLECTNISKLPTEIGKLQFLEVLDLGNNPNLKELPSTIRNFRRLIYLNLVGCQVIPPVGVLQNLTSIEVLRGILVYLNIIAQELGNLERVRDLEIRFNDGSLDLYEGLVNSLCNLHHIESLNIRCNPGETSSFELMDLLEERWVPPVHLREFKSFMPSQLSALRGWIQRDPSHLSNLSELTLWPVKDVQQDDVEIIGGLLSLRRLWIVKSIHQTQRLLVIRADGFRSMVEFRLDCGSATQILFEPGALPRAESVVISLGVRVAKEDGNRGFDLGLQEAKDVSLRWDVFVLLYCGGARVGEAKEAEAAVRRALEAHPRHPRIYIDMRPDIQEGAHDDDLCENEDEGEN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
4-944 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VTGAISNLIPKLGELLTEEFKLHKGVKKNIEDLGKELESMNAALIKIGEVPREQLDSQDKLWADEVRELSYVIEDVVDKFLVQVDGIKSDDNNNKFKGLMKRTTELLKKVKHKHGIAHAIKDIQEQLQKVADRRDRNKVFVPHPTRTIAIDPCLRALYAEATELVGIYGKRDQGLMRLLSMEGDDASNKRLKKVSIVGFGGLGKTTLARAVYEKIKGDFDCRAFVPVGQNPDMKKVLRDILIDLGNPHSDLAMLDANQLIKKLHEFLENKRYLVIIDDIWDEKLWEGINFAFSNRNNLGSRLITTTRIVSVSNSCCSSDGDSVYQMEPLSVDDSRMLFYKRIFPDENACINEFEQVSRDILKKCGGVPLAIITIASALAGDQKMKPKCEWDILLRSLGSGLTEDNSLEEMRRILSFSYSNLPSNLKTCLLYLCVYPEDSMISRDKLIWKWVAEGFVHHENQGNSLYLLGLNYFNQLINRSMIQPIYNYSGEAYACRVHDMVLDLICNLSREAKFVNLLDGTGNSMSSQSNCRRLSLQKRNEDHQARPLIDIKSMSRVRSITIFPPAIEVMPSLSRFEVLCVLDLSKCNLGEDSSLQLNLKDVGQLIQLRYLGLECTNISKLPTEIGKLQFLEVLDLGNNPNLKELPSTIRNFRRLIYLNLVGCQVIPPVGVLQNLTSIEVLRGILVYLNIIAQELGNLERVRDLEIRFNDGSLDLYEGLVNSLCNLHHIESLNIRCNPGETSSFELMDLLEERWVPPVHLREFKSFMPSQLSALRGWIQRDPSHLSNLSELTLWPVKDVQQDDVEIIGGLLSLRRLWIVKSIHQTQRLLVIRADGFRSMVEFRLDCGSATQILFEPGALPRAESVVISLGVRVAKEDGNRGFDLGLQEAKDVSLRWDVFVLLYCGGARVGEAKEAEAAVRRALEAHPRHPRIYIDMRPDIQ

HMMPanther: PTHR23155:SF217
4-944 PTHR23155:SF217,OS11G0657900 PROTEIN

VTGAISNLIPKLGELLTEEFKLHKGVKKNIEDLGKELESMNAALIKIGEVPREQLDSQDKLWADEVRELSYVIEDVVDKFLVQVDGIKSDDNNNKFKGLMKRTTELLKKVKHKHGIAHAIKDIQEQLQKVADRRDRNKVFVPHPTRTIAIDPCLRALYAEATELVGIYGKRDQGLMRLLSMEGDDASNKRLKKVSIVGFGGLGKTTLARAVYEKIKGDFDCRAFVPVGQNPDMKKVLRDILIDLGNPHSDLAMLDANQLIKKLHEFLENKRYLVIIDDIWDEKLWEGINFAFSNRNNLGSRLITTTRIVSVSNSCCSSDGDSVYQMEPLSVDDSRMLFYKRIFPDENACINEFEQVSRDILKKCGGVPLAIITIASALAGDQKMKPKCEWDILLRSLGSGLTEDNSLEEMRRILSFSYSNLPSNLKTCLLYLCVYPEDSMISRDKLIWKWVAEGFVHHENQGNSLYLLGLNYFNQLINRSMIQPIYNYSGEAYACRVHDMVLDLICNLSREAKFVNLLDGTGNSMSSQSNCRRLSLQKRNEDHQARPLIDIKSMSRVRSITIFPPAIEVMPSLSRFEVLCVLDLSKCNLGEDSSLQLNLKDVGQLIQLRYLGLECTNISKLPTEIGKLQFLEVLDLGNNPNLKELPSTIRNFRRLIYLNLVGCQVIPPVGVLQNLTSIEVLRGILVYLNIIAQELGNLERVRDLEIRFNDGSLDLYEGLVNSLCNLHHIESLNIRCNPGETSSFELMDLLEERWVPPVHLREFKSFMPSQLSALRGWIQRDPSHLSNLSELTLWPVKDVQQDDVEIIGGLLSLRRLWIVKSIHQTQRLLVIRADGFRSMVEFRLDCGSATQILFEPGALPRAESVVISLGVRVAKEDGNRGFDLGLQEAKDVSLRWDVFVLLYCGGARVGEAKEAEAAVRRALEAHPRHPRIYIDMRPDIQ

superfamily: SSF52540
150-407 SSF52540

TIAIDPCLRALYAEATELVGIYGKRDQGLMRLLSMEGDDASNKRLKKVSIVGFGGLGKTTLARAVYEKIKGDFDCRAFVPVGQNPDMKKVLRDILIDLGNPHSDLAMLDANQLIKKLHEFLENKRYLVIIDDIWDEKLWEGINFAFSNRNNLGSRLITTTRIVSVSNSCCSSDGDSVYQMEPLSVDDSRMLFYKRIFPDENACINEFEQVSRDILKKCGGVPLAIITIASALAGDQKMKPKCEWDILLRSLGSGLTED

HMMPfam: PF00931
IPR002182
191-463 NB-ARC,NBS
NB-ARC

NKRLKKVSIVGFGGLGKTTLARAVYEKIKGDFDCRAFVPVGQNPDMKKVLRDILIDLGNPHSDLAMLDANQLIKKLHEFLENKRYLVIIDDIWDEKLWEGINFAFSNRNNLGSRLITTTRIVSVSNSCCSSDGDSVYQMEPLSVDDSRMLFYKRIFPDENACINEFEQVSRDILKKCGGVPLAIITIASALAGDQKMKPKCEWDILLRSLGSGLTEDNSLEEMRRILSFSYSNLPSNLKTCLLYLCVYPEDSMISRDKLIWKWVAEGFVHHEN

Gene3D: G3DSA:3.40.50.300
191-287 G3DSA:3.40.50.300

NKRLKKVSIVGFGGLGKTTLARAVYEKIKGDFDCRAFVPVGQNPDMKKVLRDILIDLGNPHSDLAMLDANQLIKKLHEFLENKRYLVIIDDIWDEKL

FPrintScan: PR00364
IPR000767
196-211 DISEASERSIST
Disease resistance protein

KVSIVGFGGLGKTTLA

FPrintScan: PR00364
IPR000767
269-283 DISEASERSIST
Disease resistance protein

FLENKRYLVIIDDIW

Gene3D: G3DSA:3.80.10.10
288-293 G3DSA:3.80.10.10

WEGINF

FPrintScan: PR00364
IPR000767
367-381 DISEASERSIST
Disease resistance protein

CGGVPLAIITIASAL

superfamily: SSF52058
499-821 SSF52058,LRR

RVHDMVLDLICNLSREAKFVNLLDGTGNSMSSQSNCRRLSLQKRNEDHQARPLIDIKSMSRVRSITIFPPAIEVMPSLSRFEVLCVLDLSKCNLGEDSSLQLNLKDVGQLIQLRYLGLECTNISKLPTEIGKLQFLEVLDLGNNPNLKELPSTIRNFRRLIYLNLVGCQVIPPVGVLQNLTSIEVLRGILVYLNIIAQELGNLERVRDLEIRFNDGSLDLYEGLVNSLCNLHHIESLNIRCNPGETSSFELMDLLEERWVPPVHLREFKSFMPSQLSALRGWIQRDPSHLSNLSELTLWPVKDVQQDDVEIIGGLLSLRRLWI

Gene3D: G3DSA:3.80.10.10
532-752 G3DSA:3.80.10.10

SNCRRLSLQKRNEDHQARPLIDIKSMSRVRSITIFPPAIEVMPSLSRFEVLCVLDLSKCNLGEDSSLQLNLKDVGQLIQLRYLGLECTNISKLPTEIGKLQFLEVLDLGNNPNLKELPSTIRNFRRLIYLNLVGCQVIPPVGVLQNLTSIEVLRGILVYLNIIAQELGNLERVRDLEIRFNDGSLDLYEGLVNSLCNLHHIESLNIRCNPGETSSFELMDL

FPrintScan: PR00364
IPR000767
629-645 DISEASERSIST
Disease resistance protein

GKLQFLEVLDLGNNPNL

Gene3D: G3DSA:3.80.10.10
785-795 G3DSA:3.80.10.10

PSHLSNLSELT


Diseases

Disease Pathogen Avirulence gene
Powdery mildew (barley)

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox