PRGDB00061436 (Pi36)

From PRG Wiki
Revision as of 22:32, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Pi36
Gene Type Reference_R-Genes,_manually_curated
GenBank 114329517 (DQ900896)
Gene Class CNL
Domain Type NBS, LRR, Others
Chromosome 8
Gene Species Oryza sativa Indica Group

Comment?

Oryza sativa (indica cultivar-group) CC-NBS-LRR Pi36 (Pi36) gene, complete cds.

DNA Sequence

ATGGAGTTCGTCACTGGGGCGATGAGTAGCCTGATCCCCAAGCTGGGCGAGCTGCTGAAGGAGAAGTACAATCTGCAGAAGAACATAAGGGGGAAGATCGAGTCTCTCTCGGCGGAGCTCCGGCGAGCGCAAGCCGTCCTCCGCATGGTCGGCGAGGTGCCACAAGACCAGCAGAACGAGCTGGTGAAGCTCTGGGCGAGCGACCTCAGGGAGGCGTCCTACGACATGGAGGATATCATCGACGCCTTCTTGGTTCATGTCGACGACGATGGCCCCAAGCCAGCCGACCCACATGTGCTCAGGCGCCTCGGCAAGCAGGTGAAGAAACTGTTCAAGAAGACCAAGCATCGCGTCACCATCGCGGACGCAATCCAAGAAATGGAAAAGAAGCTCCTGGAGATTGATGCAAGGCATGGCAGATACCCAGTTGATAACATAGTTATCCCTGCACGTCCGACGCCTATTGATCCTCGCATCCTAAATATTGAGAAAATGGCAAACAATCTTGTTGGCATTGATGAGCCAAGGGATGAGCTTATTAAGATGTTGTCACAACATGAGCGTGACAACAATCTTAATACGTCCAATAGGAAGACAAAGATAGTATACGTCGTTGGAATGGGTGGTCTGGGCAAAACCACCCTTGCCACAGCAGTATATGAGAAGATTAAAGTGGGTTTTCCTTTGAATGCTTTTGTTCCAATCGGTCAAAATCCTAATATGAAGGCAATCTTGTGGAACATTCTTCATCGCCTTGGCTCGGAGAAGTACCTGAATTGTCCAAATATTGAGATGTTGACTGTACAGGAGCTCATCGGTGAACTCAAGCAATTCATCAAGGGAAAGAGGTTTTTTATCGTTATAGATGACATATGGGATAAGCCATCATGGCAAATACTCGAAAGTGGTTTACAAGATAATGATTACGGAAGTAAAATACTTGTAACTACTCGTAAATCTGAGGTTGCAACAATTATCAGCGATGTGTACAATATGAAACCACTTTCTCATGATAACTCTAAAGAATTATTGTATACAAGAACTGGTAGTGAAGGCAAATCTCTTGACAGTTCATCAACTGAGGCATGTGACAAGATTTTGAAGAAATGTGCTGGTGTGCCATTAGCTATCATTACGATAGCTAGCTTGTTGGCTAGTAGATCAGGTCTGGACTGGTCTGAGGTGTACAGAGCTATTGATTTTGGAGAAGAAGACAACTATGAAATGGCAAATACTAAAAGGATATTGTCTTTTAGCTACTACGATCTGCCTTCACATTTAAAGAATTGTTTGCTCTATCTAAGCATGTTTCCAGAAGATTATAAAATTGACAAAAATCATTTGATATGGATGTGGATAGCTGAAGGTTTTGTCCCTGAGAAACAAAACACAAATTTAGGATTATATGAGCTTGGGGAGAGTTACTTCAATGAGCTGATAAATAGAAGCATGATCCAGCCAATTGAGAATGAATTTTTTGGGTGTATAGAAGGTTGTCGTGTTCATGATATGGTGCTCGATCTAGCTCGTTCATTGACAAGTGAACAAAACTTTGTCACCGTATTGGATAACGATGAGCAACGGAAACCTGAAAGCACCAATGCTCGTAGGTTGGCCCTGCACCGTACGAGTATCACGAGCTATCGATTTGTTAATATGGATATGAAGAAAGTGAGGTCATTTGTTGCCACTGAGTGCAATAATGGCAATAATAGTGTGGCACCACCAAGGTTCCAAGTTTTACGTGTGTTGTCCTTGGACAAATGTAGTGGTATGGAGGATTATTACATAGAAAGTATCTTGCAGTATGCTGGAAGGCTGGGTCACCTGAGGTGCCTCCAGCTTTCCTCACACACAGAGTTTCATAGGCTCCCTAAAGAATTAGGAGATCTCAAGTTTCTAAAAATACTGGACTTGGGTGATTGTGGCGGTACAATAGAAGAGCTGCCGGAGGAGTTGGGTCTCCTGACACATTTGTTGTGTCTACGTATTCCTCGCAGATTGGAGATGTTGCCAGCTGGTTTGATCGGAAAACTGACATCGCTGCAAGAGCTATGCATAAGTCTTATCGAAGAGGTCGCTGTAAGGCACTTTGTGCAGGAGTTGGGCAACCTCAGAGAACTGAGGGTGCTCTATGCCAAAATTTATATAGGGCTGAAAGATGAGAGCATGCAGAGAGATTTTCTACAGTCCTTAGGCTGTCTACATAAGGTCCACACTATGAATATATATAGCATTGAAGTAAGGGAATGCACCAGACCAGATGCAGCAGGTTCTGTGTCCTGTCCTCGGCTCTGGCAGCTGTCATTGCCATGCATCAAGTTTTTTAGCCTACCTGTGTGGATTAACTCATCAACTCTTGGTTGCCTCTCGCATCTAGACGTGAAAGTACAGGTTGTGAGAGAGCAGGACATGGAAACCCTTGGAAGGCTCCCAATGCTCTGTTACCTCAAATTGGATTCCCAATATACCAGGCTAATAAGCATTAAGAAGCCTGCTGATGATGGCTACTTCCGAAAATTGAGATTCTTTAAAACTCCTCATTCATTTGTCCGGTTTGATCTTCATGGTTGCGAGTCCAGCAGTGGAGCATCTAGCTTCATGCCAAGACTTGAACACATTGAATTCAGTGTCGATGTTCGGTTCCTAAAAGATGCAGCAGACCTGCATGCTGGTCTTAACAACCTGCTTGCAGGCTTCAATGACTTTGGAAGAACTTCGCTCAAGAGTGTCGACGCTAGGATCCACTGCAAGGATGCCCTTGCTGCGGAGGTGCAGGAAGCCGAGGTGGCATTGGCAAATGCAGCACACGGCCATCCCAACCGTCCAGTCCTTCGAACTGATATGGCATATGAGAGGATGATGCGCTCACCTGATGACGATAAGCCAACAAGCTGGTCCGATCAAAAATTTTTTGAGACACATGTCTATCCGTCGTCGAATGACCATCATCGTTACCTTAGCTACCTCCGGTTGTTGAAGAAGCCACGCCTGGAGAAGCTTATAGTCAACATATATGTGTCCAAGGATGGTATGGTTGGGGATGTGGATGAAGCTGTGGCAGCTGCGAGGAACGTAGTCGACCATCATATCAACCATCCAACACTTGAGATAAATAGAATGGAAGAAAGTATTTCTGACCAACATCAACAGGTCCCTGAAAATAATTGA


Protein sequences

Name Description Sequence
CC-NBS-LRR Pi36 CC-NBS-LRR Pi36 [Oryza sativa Indica Group].

MEFVTGAMSSLIPKLGELLKEKYNLQKNIRGKIESLSAELRRAQAVLRMVGEVPQDQQNELVKLWASDLREASYDMEDIIDAFLVHVDDDGPKPADPHVLRRLGKQVKKLFKKTKHRVTIADAIQEMEKKLLEIDARHGRYPVDNIVIPARPTPIDPRILNIEKMANNLVGIDEPRDELIKMLSQHERDNNLNTSNRKTKIVYVVGMGGLGKTTLATAVYEKIKVGFPLNAFVPIGQNPNMKAILWNILHRLGSEKYLNCPNIEMLTVQELIGELKQFIKGKRFFIVIDDIWDKPSWQILESGLQDNDYGSKILVTTRKSEVATIISDVYNMKPLSHDNSKELLYTRTGSEGKSLDSSSTEACDKILKKCAGVPLAIITIASLLASRSGLDWSEVYRAIDFGEEDNYEMANTKRILSFSYYDLPSHLKNCLLYLSMFPEDYKIDKNHLIWMWIAEGFVPEKQNTNLGLYELGESYFNELINRSMIQPIENEFFGCIEGCRVHDMVLDLARSLTSEQNFVTVLDNDEQRKPESTNARRLALHRTSITSYRFVNMDMKKVRSFVATECNNGNNSVAPPRFQVLRVLSLDKCSGMEDYYIESILQYAGRLGHLRCLQLSSHTEFHRLPKELGDLKFLKILDLGDCGGTIEELPEELGLLTHLLCLRIPRRLEMLPAGLIGKLTSLQELCISLIEEVAVRHFVQELGNLRELRVLYAKIYIGLKDESMQRDFLQSLGCLHKVHTMNIYSIEVRECTRPDAAGSVSCPRLWQLSLPCIKFFSLPVWINSSTLGCLSHLDVKVQVVREQDMETLGRLPMLCYLKLDSQYTRLISIKKPADDGYFRKLRFFKTPHSFVRFDLHGCESSSGASSFMPRLEHIEFSVDVRFLKDAADLHAGLNNLLAGFNDFGRTSLKSVDARIHCKDALAAEVQEAEVALANAAHGHPNRPVLRTDMAYERMMRSPDDDKPTSWSDQKFFETHVYPSSNDHHRYLSYLRLLKKPRLEKLIVNIYVSKDGMVGDVDEAVAAARNVVDHHINHPTLEINRMEESISDQHQQVPENN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF194
1-819 PTHR23155:SF194,OS11G0130900 PROTEIN

MEFVTGAMSSLIPKLGELLKEKYNLQKNIRGKIESLSAELRRAQAVLRMVGEVPQDQQNELVKLWASDLREASYDMEDIIDAFLVHVDDDGPKPADPHVLRRLGKQVKKLFKKTKHRVTIADAIQEMEKKLLEIDARHGRYPVDNIVIPARPTPIDPRILNIEKMANNLVGIDEPRDELIKMLSQHERDNNLNTSNRKTKIVYVVGMGGLGKTTLATAVYEKIKVGFPLNAFVPIGQNPNMKAILWNILHRLGSEKYLNCPNIEMLTVQELIGELKQFIKGKRFFIVIDDIWDKPSWQILESGLQDNDYGSKILVTTRKSEVATIISDVYNMKPLSHDNSKELLYTRTGSEGKSLDSSSTEACDKILKKCAGVPLAIITIASLLASRSGLDWSEVYRAIDFGEEDNYEMANTKRILSFSYYDLPSHLKNCLLYLSMFPEDYKIDKNHLIWMWIAEGFVPEKQNTNLGLYELGESYFNELINRSMIQPIENEFFGCIEGCRVHDMVLDLARSLTSEQNFVTVLDNDEQRKPESTNARRLALHRTSITSYRFVNMDMKKVRSFVATECNNGNNSVAPPRFQVLRVLSLDKCSGMEDYYIESILQYAGRLGHLRCLQLSSHTEFHRLPKELGDLKFLKILDLGDCGGTIEELPEELGLLTHLLCLRIPRRLEMLPAGLIGKLTSLQELCISLIEEVAVRHFVQELGNLRELRVLYAKIYIGLKDESMQRDFLQSLGCLHKVHTMNIYSIEVRECTRPDAAGSVSCPRLWQLSLPCIKFFSLPVWINSSTLGCLSHLDVKVQVVREQDMETLGRLPMLCYLKL

HMMPanther: PTHR23155
1-819 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MEFVTGAMSSLIPKLGELLKEKYNLQKNIRGKIESLSAELRRAQAVLRMVGEVPQDQQNELVKLWASDLREASYDMEDIIDAFLVHVDDDGPKPADPHVLRRLGKQVKKLFKKTKHRVTIADAIQEMEKKLLEIDARHGRYPVDNIVIPARPTPIDPRILNIEKMANNLVGIDEPRDELIKMLSQHERDNNLNTSNRKTKIVYVVGMGGLGKTTLATAVYEKIKVGFPLNAFVPIGQNPNMKAILWNILHRLGSEKYLNCPNIEMLTVQELIGELKQFIKGKRFFIVIDDIWDKPSWQILESGLQDNDYGSKILVTTRKSEVATIISDVYNMKPLSHDNSKELLYTRTGSEGKSLDSSSTEACDKILKKCAGVPLAIITIASLLASRSGLDWSEVYRAIDFGEEDNYEMANTKRILSFSYYDLPSHLKNCLLYLSMFPEDYKIDKNHLIWMWIAEGFVPEKQNTNLGLYELGESYFNELINRSMIQPIENEFFGCIEGCRVHDMVLDLARSLTSEQNFVTVLDNDEQRKPESTNARRLALHRTSITSYRFVNMDMKKVRSFVATECNNGNNSVAPPRFQVLRVLSLDKCSGMEDYYIESILQYAGRLGHLRCLQLSSHTEFHRLPKELGDLKFLKILDLGDCGGTIEELPEELGLLTHLLCLRIPRRLEMLPAGLIGKLTSLQELCISLIEEVAVRHFVQELGNLRELRVLYAKIYIGLKDESMQRDFLQSLGCLHKVHTMNIYSIEVRECTRPDAAGSVSCPRLWQLSLPCIKFFSLPVWINSSTLGCLSHLDVKVQVVREQDMETLGRLPMLCYLKL

superfamily: SSF52540
152-399 SSF52540

PTPIDPRILNIEKMANNLVGIDEPRDELIKMLSQHERDNNLNTSNRKTKIVYVVGMGGLGKTTLATAVYEKIKVGFPLNAFVPIGQNPNMKAILWNILHRLGSEKYLNCPNIEMLTVQELIGELKQFIKGKRFFIVIDDIWDKPSWQILESGLQDNDYGSKILVTTRKSEVATIISDVYNMKPLSHDNSKELLYTRTGSEGKSLDSSSTEACDKILKKCAGVPLAIITIASLLASRSGLDWSEVYRAI

Gene3D: G3DSA:3.40.50.300
170-324 G3DSA:3.40.50.300

VGIDEPRDELIKMLSQHERDNNLNTSNRKTKIVYVVGMGGLGKTTLATAVYEKIKVGFPLNAFVPIGQNPNMKAILWNILHRLGSEKYLNCPNIEMLTVQELIGELKQFIKGKRFFIVIDDIWDKPSWQILESGLQDNDYGSKILVTTRKSEVAT

HMMPfam: PF00931
IPR002182
191-462 NB-ARC,NBS
NB-ARC

NLNTSNRKTKIVYVVGMGGLGKTTLATAVYEKIKVGFPLNAFVPIGQNPNMKAILWNILHRLGSEKYLNCPNIEMLTVQELIGELKQFIKGKRFFIVIDDIWDKPSWQILESGLQDNDYGSKILVTTRKSEVATIISDVYNMKPLSHDNSKELLYTRTGSEGKSLDSSSTEACDKILKKCAGVPLAIITIASLLASRSGLDWSEVYRAIDFGEEDNYEMANTKRILSFSYYDLPSHLKNCLLYLSMFPEDYKIDKNHLIWMWIAEGFVPEKQ

FPrintScan: PR00364
IPR000767
201-216 DISEASERSIST
Disease resistance protein

IVYVVGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
278-292 DISEASERSIST
Disease resistance protein

FIKGKRFFIVIDDIW

FPrintScan: PR00364
IPR000767
370-384 DISEASERSIST
Disease resistance protein

CAGVPLAIITIASLL

superfamily: SSF52047
533-825 SSF52047,LRR

TNARRLALHRTSITSYRFVNMDMKKVRSFVATECNNGNNSVAPPRFQVLRVLSLDKCSGMEDYYIESILQYAGRLGHLRCLQLSSHTEFHRLPKELGDLKFLKILDLGDCGGTIEELPEELGLLTHLLCLRIPRRLEMLPAGLIGKLTSLQELCISLIEEVAVRHFVQELGNLRELRVLYAKIYIGLKDESMQRDFLQSLGCLHKVHTMNIYSIEVRECTRPDAAGSVSCPRLWQLSLPCIKFFSLPVWINSSTLGCLSHLDVKVQVVREQDMETLGRLPMLCYLKLDSQYTR

Gene3D: G3DSA:3.80.10.10
597-814 G3DSA:3.80.10.10

IESILQYAGRLGHLRCLQLSSHTEFHRLPKELGDLKFLKILDLGDCGGTIEELPEELGLLTHLLCLRIPRRLEMLPAGLIGKLTSLQELCISLIEEVAVRHFVQELGNLRELRVLYAKIYIGLKDESMQRDFLQSLGCLHKVHTMNIYSIEVRECTRPDAAGSVSCPRLWQLSLPCIKFFSLPVWINSSTLGCLSHLDVKVQVVREQDMETLGRLPML

FPrintScan: PR00364
IPR000767
629-645 DISEASERSIST
Disease resistance protein

GDLKFLKILDLGDCGGT


Diseases

Disease Pathogen Avirulence gene
Rice blast disease

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox