PRGDB00061436 (Pi36)

From PRG Wiki
Revision as of 22:32, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Pi36
Gene Type Reference_R-Genes,_manually_curated
GenBank 114329517 (DQ900896)
Gene Class CNL
Domain Type NBS, LRR, Others
Chromosome 8
Gene Species Oryza sativa Indica Group

Comment?

Oryza sativa (indica cultivar-group) CC-NBS-LRR Pi36 (Pi36) gene, complete cds.

DNA Sequence

ATGGAGTTCGTCACTGGGGCGATGAGTAGCCTGATCCCCAAGCTGGGCGAGCTGCTGAAGGAGAAGTACAATCTGCAGAAGAACATAAGGGGGAAGATCGAGTCTCTCTCGGCGGAGCTCCGGCGAGCGCAAGCCGTCCTCCGCATGGTCGGCGAGGTGCCACAAGACCAGCAGAACGAGCTGGTGAAGCTCTGGGCGAGCGACCTCAGGGAGGCGTCCTACGACATGGAGGATATCATCGACGCCTTCTTGGTTCATGTCGACGACGATGGCCCCAAGCCAGCCGACCCACATGTGCTCAGGCGCCTCGGCAAGCAGGTGAAGAAACTGTTCAAGAAGACCAAGCATCGCGTCACCATCGCGGACGCAATCCAAGAAATGGAAAAGAAGCTCCTGGAGATTGATGCAAGGCATGGCAGATACCCAGTTGATAACATAGTTATCCCTGCACGTCCGACGCCTATTGATCCTCGCATCCTAAATATTGAGAAAATGGCAAACAATCTTGTTGGCATTGATGAGCCAAGGGATGAGCTTATTAAGATGTTGTCACAACATGAGCGTGACAACAATCTTAATACGTCCAATAGGAAGACAAAGATAGTATACGTCGTTGGAATGGGTGGTCTGGGCAAAACCACCCTTGCCACAGCAGTATATGAGAAGATTAAAGTGGGTTTTCCTTTGAATGCTTTTGTTCCAATCGGTCAAAATCCTAATATGAAGGCAATCTTGTGGAACATTCTTCATCGCCTTGGCTCGGAGAAGTACCTGAATTGTCCAAATATTGAGATGTTGACTGTACAGGAGCTCATCGGTGAACTCAAGCAATTCATCAAGGGAAAGAGGTTTTTTATCGTTATAGATGACATATGGGATAAGCCATCATGGCAAATACTCGAAAGTGGTTTACAAGATAATGATTACGGAAGTAAAATACTTGTAACTACTCGTAAATCTGAGGTTGCAACAATTATCAGCGATGTGTACAATATGAAACCACTTTCTCATGATAACTCTAAAGAATTATTGTATACAAGAACTGGTAGTGAAGGCAAATCTCTTGACAGTTCATCAACTGAGGCATGTGACAAGATTTTGAAGAAATGTGCTGGTGTGCCATTAGCTATCATTACGATAGCTAGCTTGTTGGCTAGTAGATCAGGTCTGGACTGGTCTGAGGTGTACAGAGCTATTGATTTTGGAGAAGAAGACAACTATGAAATGGCAAATACTAAAAGGATATTGTCTTTTAGCTACTACGATCTGCCTTCACATTTAAAGAATTGTTTGCTCTATCTAAGCATGTTTCCAGAAGATTATAAAATTGACAAAAATCATTTGATATGGATGTGGATAGCTGAAGGTTTTGTCCCTGAGAAACAAAACACAAATTTAGGATTATATGAGCTTGGGGAGAGTTACTTCAATGAGCTGATAAATAGAAGCATGATCCAGCCAATTGAGAATGAATTTTTTGGGTGTATAGAAGGTTGTCGTGTTCATGATATGGTGCTCGATCTAGCTCGTTCATTGACAAGTGAACAAAACTTTGTCACCGTATTGGATAACGATGAGCAACGGAAACCTGAAAGCACCAATGCTCGTAGGTTGGCCCTGCACCGTACGAGTATCACGAGCTATCGATTTGTTAATATGGATATGAAGAAAGTGAGGTCATTTGTTGCCACTGAGTGCAATAATGGCAATAATAGTGTGGCACCACCAAGGTTCCAAGTTTTACGTGTGTTGTCCTTGGACAAATGTAGTGGTATGGAGGATTATTACATAGAAAGTATCTTGCAGTATGCTGGAAGGCTGGGTCACCTGAGGTGCCTCCAGCTTTCCTCACACACAGAGTTTCATAGGCTCCCTAAAGAATTAGGAGATCTCAAGTTTCTAAAAATACTGGACTTGGGTGATTGTGGCGGTACAATAGAAGAGCTGCCGGAGGAGTTGGGTCTCCTGACACATTTGTTGTGTCTACGTATTCCTCGCAGATTGGAGATGTTGCCAGCTGGTTTGATCGGAAAACTGACATCGCTGCAAGAGCTATGCATAAGTCTTATCGAAGAGGTCGCTGTAAGGCACTTTGTGCAGGAGTTGGGCAACCTCAGAGAACTGAGGGTGCTCTATGCCAAAATTTATATAGGGCTGAAAGATGAGAGCATGCAGAGAGATTTTCTACAGTCCTTAGGCTGTCTACATAAGGTCCACACTATGAATATATATAGCATTGAAGTAAGGGAATGCACCAGACCAGATGCAGCAGGTTCTGTGTCCTGTCCTCGGCTCTGGCAGCTGTCATTGCCATGCATCAAGTTTTTTAGCCTACCTGTGTGGATTAACTCATCAACTCTTGGTTGCCTCTCGCATCTAGACGTGAAAGTACAGGTTGTGAGAGAGCAGGACATGGAAACCCTTGGAAGGCTCCCAATGCTCTGTTACCTCAAATTGGATTCCCAATATACCAGGCTAATAAGCATTAAGAAGCCTGCTGATGATGGCTACTTCCGAAAATTGAGATTCTTTAAAACTCCTCATTCATTTGTCCGGTTTGATCTTCATGGTTGCGAGTCCAGCAGTGGAGCATCTAGCTTCATGCCAAGACTTGAACACATTGAATTCAGTGTCGATGTTCGGTTCCTAAAAGATGCAGCAGACCTGCATGCTGGTCTTAACAACCTGCTTGCAGGCTTCAATGACTTTGGAAGAACTTCGCTCAAGAGTGTCGACGCTAGGATCCACTGCAAGGATGCCCTTGCTGCGGAGGTGCAGGAAGCCGAGGTGGCATTGGCAAATGCAGCACACGGCCATCCCAACCGTCCAGTCCTTCGAACTGATATGGCATATGAGAGGATGATGCGCTCACCTGATGACGATAAGCCAACAAGCTGGTCCGATCAAAAATTTTTTGAGACACATGTCTATCCGTCGTCGAATGACCATCATCGTTACCTTAGCTACCTCCGGTTGTTGAAGAAGCCACGCCTGGAGAAGCTTATAGTCAACATATATGTGTCCAAGGATGGTATGGTTGGGGATGTGGATGAAGCTGTGGCAGCTGCGAGGAACGTAGTCGACCATCATATCAACCATCCAACACTTGAGATAAATAGAATGGAAGAAAGTATTTCTGACCAACATCAACAGGTCCCTGAAAATAATTGA


Protein sequences

Name Description Sequence
CC-NBS-LRR Pi36 CC-NBS-LRR Pi36 [Oryza sativa Indica Group].

MEFVTGAMSSLIPKLGELLKEKYNLQKNIRGKIESLSAELRRAQAVLRMVGEVPQDQQNELVKLWASDLREASYDMEDIIDAFLVHVDDDGPKPADPHVLRRLGKQVKKLFKKTKHRVTIADAIQEMEKKLLEIDARHGRYPVDNIVIPARPTPIDPRILNIEKMANNLVGIDEPRDELIKMLSQHERDNNLNTSNRKTKIVYVVGMGGLGKTTLATAVYEKIKVGFPLNAFVPIGQNPNMKAILWNILHRLGSEKYLNCPNIEMLTVQELIGELKQFIKGKRFFIVIDDIWDKPSWQILESGLQDNDYGSKILVTTRKSEVATIISDVYNMKPLSHDNSKELLYTRTGSEGKSLDSSSTEACDKILKKCAGVPLAIITIASLLASRSGLDWSEVYRAIDFGEEDNYEMANTKRILSFSYYDLPSHLKNCLLYLSMFPEDYKIDKNHLIWMWIAEGFVPEKQNTNLGLYELGESYFNELINRSMIQPIENEFFGCIEGCRVHDMVLDLARSLTSEQNFVTVLDNDEQRKPESTNARRLALHRTSITSYRFVNMDMKKVRSFVATECNNGNNSVAPPRFQVLRVLSLDKCSGMEDYYIESILQYAGRLGHLRCLQLSSHTEFHRLPKELGDLKFLKILDLGDCGGTIEELPEELGLLTHLLCLRIPRRLEMLPAGLIGKLTSLQELCISLIEEVAVRHFVQELGNLRELRVLYAKIYIGLKDESMQRDFLQSLGCLHKVHTMNIYSIEVRECTRPDAAGSVSCPRLWQLSLPCIKFFSLPVWINSSTLGCLSHLDVKVQVVREQDMETLGRLPMLCYLKLDSQYTRLISIKKPADDGYFRKLRFFKTPHSFVRFDLHGCESSSGASSFMPRLEHIEFSVDVRFLKDAADLHAGLNNLLAGFNDFGRTSLKSVDARIHCKDALAAEVQEAEVALANAAHGHPNRPVLRTDMAYERMMRSPDDDKPTSWSDQKFFETHVYPSSNDHHRYLSYLRLLKKPRLEKLIVNIYVSKDGMVGDVDEAVAAARNVVDHHINHPTLEINRMEESISDQHQQVPENN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF194
1-819 PTHR23155:SF194,OS11G0130900 PROTEIN

MEFVTGAMSSLIPKLGELLKEKYNLQKNIRGKIESLSAELRRAQAVLRMVGEVPQDQQNELVKLWASDLREASYDMEDIIDAFLVHVDDDGPKPADPHVLRRLGKQVKKLFKKTKHRVTIADAIQEMEKKLLEIDARHGRYPVDNIVIPARPTPIDPRILNIEKMANNLVGIDEPRDELIKMLSQHERDNNLNTSNRKTKIVYVVGMGGLGKTTLATAVYEKIKVGFPLNAFVPIGQNPNMKAILWNILHRLGSEKYLNCPNIEMLTVQELIGELKQFIKGKRFFIVIDDIWDKPSWQILESGLQDNDYGSKILVTTRKSEVATIISDVYNMKPLSHDNSKELLYTRTGSEGKSLDSSSTEACDKILKKCAGVPLAIITIASLLASRSGLDWSEVYRAIDFGEEDNYEMANTKRILSFSYYDLPSHLKNCLLYLSMFPEDYKIDKNHLIWMWIAEGFVPEKQNTNLGLYELGESYFNELINRSMIQPIENEFFGCIEGCRVHDMVLDLARSLTSEQNFVTVLDNDEQRKPESTNARRLALHRTSITSYRFVNMDMKKVRSFVATECNNGNNSVAPPRFQVLRVLSLDKCSGMEDYYIESILQYAGRLGHLRCLQLSSHTEFHRLPKELGDLKFLKILDLGDCGGTIEELPEELGLLTHLLCLRIPRRLEMLPAGLIGKLTSLQELCISLIEEVAVRHFVQELGNLRELRVLYAKIYIGLKDESMQRDFLQSLGCLHKVHTMNIYSIEVRECTRPDAAGSVSCPRLWQLSLPCIKFFSLPVWINSSTLGCLSHLDVKVQVVREQDMETLGRLPMLCYLKL

HMMPanther: PTHR23155
1-819 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MEFVTGAMSSLIPKLGELLKEKYNLQKNIRGKIESLSAELRRAQAVLRMVGEVPQDQQNELVKLWASDLREASYDMEDIIDAFLVHVDDDGPKPADPHVLRRLGKQVKKLFKKTKHRVTIADAIQEMEKKLLEIDARHGRYPVDNIVIPARPTPIDPRILNIEKMANNLVGIDEPRDELIKMLSQHERDNNLNTSNRKTKIVYVVGMGGLGKTTLATAVYEKIKVGFPLNAFVPIGQNPNMKAILWNILHRLGSEKYLNCPNIEMLTVQELIGELKQFIKGKRFFIVIDDIWDKPSWQILESGLQDNDYGSKILVTTRKSEVATIISDVYNMKPLSHDNSKELLYTRTGSEGKSLDSSSTEACDKILKKCAGVPLAIITIASLLASRSGLDWSEVYRAIDFGEEDNYEMANTKRILSFSYYDLPSHLKNCLLYLSMFPEDYKIDKNHLIWMWIAEGFVPEKQNTNLGLYELGESYFNELINRSMIQPIENEFFGCIEGCRVHDMVLDLARSLTSEQNFVTVLDNDEQRKPESTNARRLALHRTSITSYRFVNMDMKKVRSFVATECNNGNNSVAPPRFQVLRVLSLDKCSGMEDYYIESILQYAGRLGHLRCLQLSSHTEFHRLPKELGDLKFLKILDLGDCGGTIEELPEELGLLTHLLCLRIPRRLEMLPAGLIGKLTSLQELCISLIEEVAVRHFVQELGNLRELRVLYAKIYIGLKDESMQRDFLQSLGCLHKVHTMNIYSIEVRECTRPDAAGSVSCPRLWQLSLPCIKFFSLPVWINSSTLGCLSHLDVKVQVVREQDMETLGRLPMLCYLKL

superfamily: SSF52540
152-399 SSF52540

PTPIDPRILNIEKMANNLVGIDEPRDELIKMLSQHERDNNLNTSNRKTKIVYVVGMGGLGKTTLATAVYEKIKVGFPLNAFVPIGQNPNMKAILWNILHRLGSEKYLNCPNIEMLTVQELIGELKQFIKGKRFFIVIDDIWDKPSWQILESGLQDNDYGSKILVTTRKSEVATIISDVYNMKPLSHDNSKELLYTRTGSEGKSLDSSSTEACDKILKKCAGVPLAIITIASLLASRSGLDWSEVYRAI

Gene3D: G3DSA:3.40.50.300
170-324 G3DSA:3.40.50.300

VGIDEPRDELIKMLSQHERDNNLNTSNRKTKIVYVVGMGGLGKTTLATAVYEKIKVGFPLNAFVPIGQNPNMKAILWNILHRLGSEKYLNCPNIEMLTVQELIGELKQFIKGKRFFIVIDDIWDKPSWQILESGLQDNDYGSKILVTTRKSEVAT

HMMPfam: PF00931
IPR002182
191-462 NB-ARC,NBS
NB-ARC

NLNTSNRKTKIVYVVGMGGLGKTTLATAVYEKIKVGFPLNAFVPIGQNPNMKAILWNILHRLGSEKYLNCPNIEMLTVQELIGELKQFIKGKRFFIVIDDIWDKPSWQILESGLQDNDYGSKILVTTRKSEVATIISDVYNMKPLSHDNSKELLYTRTGSEGKSLDSSSTEACDKILKKCAGVPLAIITIASLLASRSGLDWSEVYRAIDFGEEDNYEMANTKRILSFSYYDLPSHLKNCLLYLSMFPEDYKIDKNHLIWMWIAEGFVPEKQ

FPrintScan: PR00364
IPR000767
201-216 DISEASERSIST
Disease resistance protein

IVYVVGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
278-292 DISEASERSIST
Disease resistance protein

FIKGKRFFIVIDDIW

FPrintScan: PR00364
IPR000767
370-384 DISEASERSIST
Disease resistance protein

CAGVPLAIITIASLL

superfamily: SSF52047
533-825 SSF52047,LRR

TNARRLALHRTSITSYRFVNMDMKKVRSFVATECNNGNNSVAPPRFQVLRVLSLDKCSGMEDYYIESILQYAGRLGHLRCLQLSSHTEFHRLPKELGDLKFLKILDLGDCGGTIEELPEELGLLTHLLCLRIPRRLEMLPAGLIGKLTSLQELCISLIEEVAVRHFVQELGNLRELRVLYAKIYIGLKDESMQRDFLQSLGCLHKVHTMNIYSIEVRECTRPDAAGSVSCPRLWQLSLPCIKFFSLPVWINSSTLGCLSHLDVKVQVVREQDMETLGRLPMLCYLKLDSQYTR

Gene3D: G3DSA:3.80.10.10
597-814 G3DSA:3.80.10.10

IESILQYAGRLGHLRCLQLSSHTEFHRLPKELGDLKFLKILDLGDCGGTIEELPEELGLLTHLLCLRIPRRLEMLPAGLIGKLTSLQELCISLIEEVAVRHFVQELGNLRELRVLYAKIYIGLKDESMQRDFLQSLGCLHKVHTMNIYSIEVRECTRPDAAGSVSCPRLWQLSLPCIKFFSLPVWINSSTLGCLSHLDVKVQVVREQDMETLGRLPML

FPrintScan: PR00364
IPR000767
629-645 DISEASERSIST
Disease resistance protein

GDLKFLKILDLGDCGGT


Diseases

Disease Pathogen Avirulence gene
Rice blast disease

List of References

Xinqiong Liu, Fei Lin, Ling Wang, Qinghua Pan
The in silico map-based cloning of Pi36, a rice coiled-coil nucleotide-binding site leucine-rich repeat gene that confers race-specific resistance to the blast fungus.
Genetics: 2007, 176(4);2541-9
PubMed:17507669 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox