PRGDB00061441 (SSI4)

From PRG Wiki
Revision as of 22:32, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
SSI4
Gene Type Reference_R-Genes,_manually_curated
GenBank 27466163 (AY179750)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Chromosome 5
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana TIR-NBS-LRR (SSI4) gene, complete cds.

DNA Sequence

ATGGCTTCTTCTTCTTGTTTGTCTTGCATCAAGAGATACCAAGTCTTTTCGAGCTTCCACGGTCCAGATGTCCGTAAAGGGTTTCTCAGTCATTTACACAGTCTCTTTGCAAGCAAAGGTATCACGACTTTCAATGATCAGAAGATCGAGAGAGGCCAGACGATCGGACCTGAGCTCATACAAGGGATTAGAGAAGCTAGAGTCTCGATCGTTGTGCTCTCGAAGAAGTACGCTTCTTCCAGCTGGTGTTTAGATGAACTTGTGGAAATCTTGAACTGCAAAGAAGCTTTGGTGCAGATTGTGATGACGGTTTTTTACGAAGTTGATCCGTCAGATGTTAAGAAACAGAGTGGAGAGTTCGGGAAAGTTTTTGAGAAGACTTGTCAAGGGAAAAATGAGGAAGTGGAGCAGAGATGGAGAAATGCTTTGGCAGATGTCGCTATCATTGCTGGGGAACACTCTCTTAATTGGGATAATGAAGCAGATATGATCCAAAAGATTGTTACAGATGTTTCAGACAAACTGAATCTCACACCGTCGAGGGATTTTGAGGGGATGGTAGGGATGGAAGCTCACTTGACAGAATTGAAGTCTTTGTTAAGCCTGGAAAGTGATGAAGTCAAGATGATTGGAATTTGGGGTCCAGCGGGAATTGGTAAGACTACCATTGCTAGAGCTTTATTCGACAGACTCTCTAGTATTTTTCCGCTTATATGTTTTATGGAGAACCTCAAGGGAAGTCTTACGGGTGTTGCTGACCATGATTCCAAGTTGAGGTTGCAAAACCAACTTCTGTCTAAGATTTTGAACCAAGAGAATATGAAGATACATCATTTAGGCGCAATACGAGAAAGGCTACACGATCAAAGAGTGCTCATCATTCTTGACGATGTAGATGATCTTGAGCAATTAGAGGTATTGGCTGAAGATCCTTCTTGGTTTGGTTCTGGCAGTCGGATCATCGTTACCACAGAAGATAAGAAGATTTTGAAAGCACATAGGATTAAGGATATCTACCATGTGAATTTTCCATCGAAGAAAGAAGCTCTTGAGATCTTATGTCTCTCTACATTCAAACAAAGCTCTATACCAGATGGTTTTGAAGAGCTTGCCAATAAAGTAGCTGAGCTTTGCGGCAATCTTCCATTAGGCCTTCGTGTCGTGGGTTCATCTTTGCGTGGGGAGAGCAAGCAAGAGTGGGAACTTCAATTGTCTAGTATCGAAGCTAGTCTTGATGGAAAAATTGAGACCACATTAAAAGTGGGATATGAAAGATTGTCGAAGAAAAATCAATCTCTATTCCTTCACATTGCATGCTTCTTCAACAATCAAGAGGTTGATTACGTGACAGCCTTGCTAGCTGACAGGAATTTGGATGTTGGAAATGGTTTCAATATCCTAGCCGATAGATCTCTCGTGCGTATATCTACCTATGGTGATATAGTGATGCACCATCTACTACAACAATTGGGTAGACAGATAGTTCATGAACAGTCTGACGAGCCCGGGAAACGTGAATTTATAATTGAGCCAGAAGAGATTCGTGATGTACTGACAGATGAAACAGGTACTGGATCTGTCAAAGGTATATCATTTGATGCATCCAATAGCGAAGAGGTTTCGGTAGGTAAGGGGGCTTTTGAAGGAATGCCTAATCTCCAATTCCTAAGAATCTATAGAGAATATTTCAATAGTGAAGGTACTTTGCAAATACCAGAAGATATGAAGTATTTACCTCCTGTTAGGTTACTACATTGGGAAAATTACCCAAGAAAAAGTCTTCCTCAGAGATTCCACCCGGAACATCTCGTCAAAATTTATATGCCACGCAGCAAGCTCAAGAAGCTCTGGGGAGGAATCCAGCCCCTTCCTAATATCAAGAGCATAGATCTGAGCTTTTCCATTAGATTGAAAGAAATCCCAAATCTTTCGAATGCTACTAATCTCGAGACATTAAACCTTACTCACTGCAAAACTTTGGTGGAACTTCCCTCCTCTATTTCGAATCTACACAAACTGAAAAAGCTTAAGATGTCAGGGTGCGAAAACCTACGAGTTATTCCCACCAACATCAACTTAGCATCTCTTGAGAGACTCGACATGAGTGGTTGCTCACGATTGAGAACTTTTCCAGATATCTCCAGCAACATCGACACACTCAATCTCGGAGATACAAAGATAGAAGATGTCCCTCCATCAGTTGGATGTTGGTCTCGTCTTATTCAGCTTAACATTAGCTGCGGACCCCTCACGAGATTGATGCATGTACCACCATGTATAACTATCCTAATTCTTAAAGGCAGTGATATAGAGAGGATTCCAGAAAGCATCATAGGTCTCACTCGTCTACATTGGCTGATTGTCGAAAGCTGCATAAAACTCAAGTCAATTCTGGGTCTCCCCTCCTCCCTCCAGGGCCTAGATGCAAATGATTGTGTATCACTCAAGAGAGTACGCTTCTCTTTCCATAACCCAATCCACATACTCAATTTCAACAACTGTTTGAAACTGGATGAAGAAGCAAAAAGAGGAATCATACAACGATCAGTGTCCGGGTACATATGCTTACCAGGTAAAAATATCCCTGAAGAGTTCACTCACAAAGCAACAGGGAGATCCATAACCATCCCTCTGGCACCTGGTACTCTCTCTGCTTCCTCAAGGTTTAAGGCTTCCATTCTCATTTTGCCAGTTGAGAGCTACGAAAATGAAGTTATACGTTGTAGTATAAGAACCAAAGGAGGTGTTGAAGTTCATTGCTGCGAGCTTCCATATCACTTTTTGCGTTTTCGGTCAGAACACCTGTATATATTTCATGGTGACTTGTTTCCCCAAGGAAACAAATACCATGAAGTGGATGTGACTATGAGAGAGATTACATTTGAGTTCAGCTACACTAAAATCGGTGACAAGATTATTGAGTGTGGTGTACAGATCATGACAGAGGGAGCTGAGGGTGACAGTAGCAGGGAATTGGACAGCTTTGAAACTGAGAGTAGCAGCAGCCAAGTGGGCAACTTTGAATTTGGAGGCAACAACAATCACCACACAGATGGAAATGGAGATGGAAACTATGAAGCAGAAGGTTCCAAGTTCTCTCAAGATGAAAACATCAAAACCAGCAAACGTACTGGTTTTATGAGTTGGCTTCGGAAGCTTGGTCAGTGA


Protein sequences

Name Description Sequence
TIR-NBS-LRR TIR-NBS-LRR [Arabidopsis thaliana].

MASSSCLSCIKRYQVFSSFHGPDVRKGFLSHLHSLFASKGITTFNDQKIERGQTIGPELIQGIREARVSIVVLSKKYASSSWCLDELVEILNCKEALVQIVMTVFYEVDPSDVKKQSGEFGKVFEKTCQGKNEEVEQRWRNALADVAIIAGEHSLNWDNEADMIQKIVTDVSDKLNLTPSRDFEGMVGMEAHLTELKSLLSLESDEVKMIGIWGPAGIGKTTIARALFDRLSSIFPLICFMENLKGSLTGVADHDSKLRLQNQLLSKILNQENMKIHHLGAIRERLHDQRVLIILDDVDDLEQLEVLAEDPSWFGSGSRIIVTTEDKKILKAHRIKDIYHVNFPSKKEALEILCLSTFKQSSIPDGFEELANKVAELCGNLPLGLRVVGSSLRGESKQEWELQLSSIEASLDGKIETTLKVGYERLSKKNQSLFLHIACFFNNQEVDYVTALLADRNLDVGNGFNILADRSLVRISTYGDIVMHHLLQQLGRQIVHEQSDEPGKREFIIEPEEIRDVLTDETGTGSVKGISFDASNSEEVSVGKGAFEGMPNLQFLRIYREYFNSEGTLQIPEDMKYLPPVRLLHWENYPRKSLPQRFHPEHLVKIYMPRSKLKKLWGGIQPLPNIKSIDLSFSIRLKEIPNLSNATNLETLNLTHCKTLVELPSSISNLHKLKKLKMSGCENLRVIPTNINLASLERLDMSGCSRLRTFPDISSNIDTLNLGDTKIEDVPPSVGCWSRLIQLNISCGPLTRLMHVPPCITILILKGSDIERIPESIIGLTRLHWLIVESCIKLKSILGLPSSLQGLDANDCVSLKRVRFSFHNPIHILNFNNCLKLDEEAKRGIIQRSVSGYICLPGKNIPEEFTHKATGRSITIPLAPGTLSASSRFKASILILPVESYENEVIRCSIRTKGGVEVHCCELPYHFLRFRSEHLYIFHGDLFPQGNKYHEVDVTMREITFEFSYTKIGDKIIECGVQIMTEGAEGDSSRELDSFETESSSSQVGNFEFGGNNNHHTDGNGDGNYEAEGSKFSQDENIKTSKRTGFMSWLRKLGQ

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MASSSCLSCIKRYQVFSSFHGPDVRKGFLSHLHSLFASKGITTFNDQKIERGQTIGPELIQGIREARVSIVVLSKKYASSSWCLDELVEILNCKEALVQIVMTVFYEVDPSDVKKQSGEFGKVFEKTCQGKNEEVEQRWRNALADVAIIAGE

Gene3D: G3DSA:3.40.50.10140
11-145 G3DSA:3.40.50.10140

KRYQVFSSFHGPDVRKGFLSHLHSLFASKGITTFNDQKIERGQTIGPELIQGIREARVSIVVLSKKYASSSWCLDELVEILNCKEALVQIVMTVFYEVDPSDVKKQSGEFGKVFEKTCQGKNEEVEQRWRNALAD

ProfileScan: PS50104
IPR000157
11-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KRYQVFSSFHGPDVRKGFLSHLHSLFASKGITTFNDQKIERGQTIGPELIQGIREARVSIVVLSKKYASSSWCLDELVEILNCKEALVQIVMTVFYEVDPSDVKKQSGEFGKVFEKTCQGKNEEVEQRWRNALADVAII

HMMSmart: SM00255
IPR000157
12-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RYQVFSSFHGPDVRKGFLSHLHSLFASKGITTFNDQKIERGQTIGPELIQGIREARVSIVVLSKKYASSSWCLDELVEILNCKEALVQIVMTVFYEVDPSDVKKQSGEFGKVFEKTCQGKNEEVEQRWRNALADVAII

HMMPfam: PF01582
IPR000157
15-144 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFSSFHGPDVRKGFLSHLHSLFASKGITTFNDQKIERGQTIGPELIQGIREARVSIVVLSKKYASSSWCLDELVEILNCKEALVQIVMTVFYEVDPSDVKKQSGEFGKVFEKTCQGKNEEVEQRWRNALA

HMMPanther: PTHR11017:SF20
35-1008 PTHR11017:SF20,SUBFAMILY NOT NAMED

LFASKGITTFNDQKIERGQTIGPELIQGIREARVSIVVLSKKYASSSWCLDELVEILNCKEALVQIVMTVFYEVDPSDVKKQSGEFGKVFEKTCQGKNEEVEQRWRNALADVAIIAGEHSLNWDNEADMIQKIVTDVSDKLNLTPSRDFEGMVGMEAHLTELKSLLSLESDEVKMIGIWGPAGIGKTTIARALFDRLSSIFPLICFMENLKGSLTGVADHDSKLRLQNQLLSKILNQENMKIHHLGAIRERLHDQRVLIILDDVDDLEQLEVLAEDPSWFGSGSRIIVTTEDKKILKAHRIKDIYHVNFPSKKEALEILCLSTFKQSSIPDGFEELANKVAELCGNLPLGLRVVGSSLRGESKQEWELQLSSIEASLDGKIETTLKVGYERLSKKNQSLFLHIACFFNNQEVDYVTALLADRNLDVGNGFNILADRSLVRISTYGDIVMHHLLQQLGRQIVHEQSDEPGKREFIIEPEEIRDVLTDETGTGSVKGISFDASNSEEVSVGKGAFEGMPNLQFLRIYREYFNSEGTLQIPEDMKYLPPVRLLHWENYPRKSLPQRFHPEHLVKIYMPRSKLKKLWGGIQPLPNIKSIDLSFSIRLKEIPNLSNATNLETLNLTHCKTLVELPSSISNLHKLKKLKMSGCENLRVIPTNINLASLERLDMSGCSRLRTFPDISSNIDTLNLGDTKIEDVPPSVGCWSRLIQLNISCGPLTRLMHVPPCITILILKGSDIERIPESIIGLTRLHWLIVESCIKLKSILGLPSSLQGLDANDCVSLKRVRFSFHNPIHILNFNNCLKLDEEAKRGIIQRSVSGYICLPGKNIPEEFTHKATGRSITIPLAPGTLSASSRFKASILILPVESYENEVIRCSIRTKGGVEVHCCELPYHFLRFRSEHLYIFHGDLFPQGNKYHEVDVTMREITFEFSYTKIGDKIIECGVQIMTEGAEGDSSRELDSFETESSSSQVGNFE

HMMPanther: PTHR11017
35-1008 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LFASKGITTFNDQKIERGQTIGPELIQGIREARVSIVVLSKKYASSSWCLDELVEILNCKEALVQIVMTVFYEVDPSDVKKQSGEFGKVFEKTCQGKNEEVEQRWRNALADVAIIAGEHSLNWDNEADMIQKIVTDVSDKLNLTPSRDFEGMVGMEAHLTELKSLLSLESDEVKMIGIWGPAGIGKTTIARALFDRLSSIFPLICFMENLKGSLTGVADHDSKLRLQNQLLSKILNQENMKIHHLGAIRERLHDQRVLIILDDVDDLEQLEVLAEDPSWFGSGSRIIVTTEDKKILKAHRIKDIYHVNFPSKKEALEILCLSTFKQSSIPDGFEELANKVAELCGNLPLGLRVVGSSLRGESKQEWELQLSSIEASLDGKIETTLKVGYERLSKKNQSLFLHIACFFNNQEVDYVTALLADRNLDVGNGFNILADRSLVRISTYGDIVMHHLLQQLGRQIVHEQSDEPGKREFIIEPEEIRDVLTDETGTGSVKGISFDASNSEEVSVGKGAFEGMPNLQFLRIYREYFNSEGTLQIPEDMKYLPPVRLLHWENYPRKSLPQRFHPEHLVKIYMPRSKLKKLWGGIQPLPNIKSIDLSFSIRLKEIPNLSNATNLETLNLTHCKTLVELPSSISNLHKLKKLKMSGCENLRVIPTNINLASLERLDMSGCSRLRTFPDISSNIDTLNLGDTKIEDVPPSVGCWSRLIQLNISCGPLTRLMHVPPCITILILKGSDIERIPESIIGLTRLHWLIVESCIKLKSILGLPSSLQGLDANDCVSLKRVRFSFHNPIHILNFNNCLKLDEEAKRGIIQRSVSGYICLPGKNIPEEFTHKATGRSITIPLAPGTLSASSRFKASILILPVESYENEVIRCSIRTKGGVEVHCCELPYHFLRFRSEHLYIFHGDLFPQGNKYHEVDVTMREITFEFSYTKIGDKIIECGVQIMTEGAEGDSSRELDSFETESSSSQVGNFE

superfamily: SSF52540
169-415 SSF52540

TDVSDKLNLTPSRDFEGMVGMEAHLTELKSLLSLESDEVKMIGIWGPAGIGKTTIARALFDRLSSIFPLICFMENLKGSLTGVADHDSKLRLQNQLLSKILNQENMKIHHLGAIRERLHDQRVLIILDDVDDLEQLEVLAEDPSWFGSGSRIIVTTEDKKILKAHRIKDIYHVNFPSKKEALEILCLSTFKQSSIPDGFEELANKVAELCGNLPLGLRVVGSSLRGESKQEWELQLSSIEASLDGKI

HMMPfam: PF00931
IPR002182
190-447 NB-ARC,NBS
NB-ARC

EAHLTELKSLLSLESDEVKMIGIWGPAGIGKTTIARALFDRLSSIFPLICFMENLKGSLTGVADHDSKLRLQNQLLSKILNQENMKIHHLGAIRERLHDQRVLIILDDVDDLEQLEVLAEDPSWFGSGSRIIVTTEDKKILKAHRIKDIYHVNFPSKKEALEILCLSTFKQSSIPDGFEELANKVAELCGNLPLGLRVVGSSLRGESKQEWELQLSSIEASLDGKIETTLKVGYERLSKKNQSLFLHIACFFNNQEVD

Gene3D: G3DSA:3.40.50.300
206-360 G3DSA:3.40.50.300

EVKMIGIWGPAGIGKTTIARALFDRLSSIFPLICFMENLKGSLTGVADHDSKLRLQNQLLSKILNQENMKIHHLGAIRERLHDQRVLIILDDVDDLEQLEVLAEDPSWFGSGSRIIVTTEDKKILKAHRIKDIYHVNFPSKKEALEILCLSTFKQ

HMMSmart: SM00382
IPR003593
206-344 AAA,NBS
AAA+ ATPase domain

EVKMIGIWGPAGIGKTTIARALFDRLSSIFPLICFMENLKGSLTGVADHDSKLRLQNQLLSKILNQENMKIHHLGAIRERLHDQRVLIILDDVDDLEQLEVLAEDPSWFGSGSRIIVTTEDKKILKAHRIKDIYHVNFP

FPrintScan: PR00364
IPR000767
209-224 DISEASERSIST
Disease resistance protein

MIGIWGPAGIGKTTIA

FPrintScan: PR00364
IPR000767
285-299 DISEASERSIST
Disease resistance protein

RLHDQRVLIILDDVD

FPrintScan: PR00364
IPR000767
378-392 DISEASERSIST
Disease resistance protein

CGNLPLGLRVVGSSL

superfamily: SSF46785
413-519 SSF46785

GKIETTLKVGYERLSKKNQSLFLHIACFFNNQEVDYVTALLADRNLDVGNGFNILADRSLVRISTYGDIVMHHLLQQLGRQIVHEQSDEPGKREFIIEPEEIRDVLT

superfamily: SSF52058
493-837 SSF52058,LRR

QIVHEQSDEPGKREFIIEPEEIRDVLTDETGTGSVKGISFDASNSEEVSVGKGAFEGMPNLQFLRIYREYFNSEGTLQIPEDMKYLPPVRLLHWENYPRKSLPQRFHPEHLVKIYMPRSKLKKLWGGIQPLPNIKSIDLSFSIRLKEIPNLSNATNLETLNLTHCKTLVELPSSISNLHKLKKLKMSGCENLRVIPTNINLASLERLDMSGCSRLRTFPDISSNIDTLNLGDTKIEDVPPSVGCWSRLIQLNISCGPLTRLMHVPPCITILILKGSDIERIPESIIGLTRLHWLIVESCIKLKSILGLPSSLQGLDANDCVSLKRVRFSFHNPIHILNFNNCLKL

Gene3D: G3DSA:3.80.10.10
531-821 G3DSA:3.80.10.10

SFDASNSEEVSVGKGAFEGMPNLQFLRIYREYFNSEGTLQIPEDMKYLPPVRLLHWENYPRKSLPQRFHPEHLVKIYMPRSKLKKLWGGIQPLPNIKSIDLSFSIRLKEIPNLSNATNLETLNLTHCKTLVELPSSISNLHKLKKLKMSGCENLRVIPTNINLASLERLDMSGCSRLRTFPDISSNIDTLNLGDTKIEDVPPSVGCWSRLIQLNISCGPLTRLMHVPPCITILILKGSDIERIPESIIGLTRLHWLIVESCIKLKSILGLPSSLQGLDANDCVSLKRVRFS

HMMPfam: PF07725
IPR011713
602-621 LRR_3
Leucine-rich repeat 3

HLVKIYMPRSKLKKLWGGIQ

HMMPfam: PF00560
IPR001611
648-670 LRR_1
Leucine-rich repeat

NLETLNLTHCKTLVELPSSISNL

FPrintScan: PR00364
IPR000767
691-707 DISEASERSIST
Disease resistance protein

INLASLERLDMSGCSRL

HMMPfam: PF00560
IPR001611
695-714 LRR_1
Leucine-rich repeat

SLERLDMSGCSRLRTFPDIS


Diseases

Disease Pathogen Avirulence gene
Bacterial Blight Pseudomonas syringae

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox