PRGDB00061443 (Piz-t)

From PRG Wiki
Revision as of 22:32, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Piz-t
Gene Type Reference_R-Genes,_manually_curated
GenBank 85682843 (DQ352040)
Gene Class CNL
Domain Type NBS, LRR, Others
Chromosome 6
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Piz-t (Piz-t) gene, complete cds.

DNA Sequence

ATGGCGGAGACGGTGCTGAGCATGGCGAGGTCGCTGGTGGGCAGCGCCATCAGCAAGGCCGCCTCCGCTGCTGCCGACGAGACCAGCCTCCTGCTGGGCGTCGAGAAAGACATCTGGTATATCAAAGATGAGCTAAAAACGATGCAAGCATTCCTTAGAGCTGCTGAACTTATGAAAAAGAAAGATGAACTATTAAAGGTTTGGGCAGAGCAAATACGTGACCTGTCATATGACATTGAAGATTCCCTTGATGAATTTAAGGTCCATATTGAAAGCCAAACCCTATTTCGTCAGTTGGTGAAACTCAGAGAACGCCACCGAATTGCTATCCGTATCCACAACCTTAAATCAAGAGTTGAAGAAGTGAGTAGCAGGAACACACGCTACAGTTTAGTCAAGCCTATTTCCTCTGGCACAGAGATTGACATGGATTCCTATGCAGAAGACATTCGTAATCAGTCAGCTCGCAATGTGGATGAAGCTGAGCTTGTTGGGTTTTCTGACTCCAAGAAAAGGCTGCTTGAAATGATCGATACCAATGCTAATGATGGTCCGGCCAAGGTAATCTGTGTTGTTGGGATGGGTGGTTTAGGCAAGACAGCTCTTTCGAGGAAGATCTTTGAAAGCGAAGAAGACATTAGGAAGAACTTCCCTTGCAATGCTTGGATTACAGTGTCACAATCATTTCACAGGATTGAGCTACTTAAAGATATGATACGCCAACTTCTTGGCCCCAGTTCTCTGGATCAACTCTTGCAAGAATTGCAAGGGAAGGTGGTGGTGCAAGTACATCATCTTTCTGAGTACCTGATAGAAGAGCTCAAGGAGAAGAGGTACTTTGTTGTTCTAGATGATCTATGGATTTTACATGATTGGAATTGGATAAATGAAATTGCATTTCCTAAGAACAATAAGAAGGGCAGTCGAATAGTAATAACCACTCGGAATGTTGATCTTGCGGAGAAGTGTGCCACAGCCTCACTGGTGTACCACCTTGATTTCTTGCAGATGAACGATGCCATAACATTGCTACTGAGAAAAACAAATAAAAATCATGAAGACATGGAATCAAATAAAAATATGCAAAAGATGGTTGAACGAATTGTAAATAAATGTGGTCGTCTACCATTAGCAATACTTACAATAGGAGCTGTGCTTGCAACTAAACAGGTGTCAGAATGGGAGAAATTCTATGAACACCTTCCTTCAGAACTAGAAATAAACCCAAGCCTGGAAGCTTTGAGGAGAATGGTGACCCTAGGTTACAACCACCTACCATCCCATTTGAAACCATGCTTTTTGTATCTAAGTATCTTTCCTGAGGATTTTGAAATCAAAAGGAATCGTCTAGTAGGTAGATGGATAGCAGAAGGGTTTGTTAGACCAAAGGTTGGGATGACGACTAAGGATGTCGGAGAAAGTTACTTTAATGAGCTAATCAACCGAAGTATGATTCAACGATCAAGAGTGGGCATAGCAGGAAAAATTAAGACTTGTCGAATTCATGATATCATCCGTGATATCACAGTTTCAATCTCGAGACAGGAAAATTTTGTATTATTACCAATGGGAGATGGCTCTGATTTAGTTCAGGAAAACACTCGCCACATAGCATTCCATGGGAGTATGTCCTGCAAAACTGGATTGGATTGGAGCATTATTCGATCATTAGCTATTTTTGGTGACAGACCCAAGAGTCTAGCACATGCAGTTTGTCCAGATCAATTGAGGATGTTACGGGTCTTGGATCTTGAAGATGTGACATTCTTAATCACTCAAAAAGATTTCGACCGTATTGCATTGTTGTGCCACTTGAAATACTTGAGTATTGGATATTCGTCATCCATATATTCACTTCCCAGATCCATTGGTAAACTACAGGGCCTACAAACTTTGAACATGCCGAGCACATACATTGCAGCACTACCAAGTGAGATCAGTAAACTCCAATGTCTGCATACTCTTCGTTGTATAGGACAGTTTCATTATGACAACTTTAGTCTAAACCACCCAATGAAGTGCATAACTAACACAATATGCCTGCCTAAAGTATTCACACCTTTAGTTAGTCGCGATGATCGTGCAAAACAAATTGCTGAATTGCACATGGCCACCAAAAGTTGCTGGTCTGAATCAATCGGTGTGAAGGTACCCAAAGGAATAGGTAAGTTGCGAGACTTGCAGGTTCTAGAGTATGTAGATATCAGGCGGACCAGTAGTAGAGCAATCAAAGAGCTGGGGCAGTTAAGCAAGCTGAGGAAATTAGGTGTGACAACAAACGGGTCGACAAAGGAAAAATGTAAGATACTTTATGCAGCCATTGAGAAGCTCTCTTCCCTCCAATCTCTCCATGTGGATGCTGTGTTATTCTCAGGTATTATTGGAACACTTGAGTGCCTAGATTCTATTTCATCTCCTCCTCCCCTACTGAGGACACTCGTGTTGGATGGAATTCTTGAGGAGATGCCTAACTGGATTGAGCAGCTCATGCACCTGAAGAAGATCTACTTATTGAGCAGCAAACTAAAGGAAGGTAAAACCATGCTGATACTTGGGGCACTGCCCAACCTCATGGTCCTTCATCTTTATCGGAATGCTTACCTTGGGGAGAAGCTAGTATTCAAAACAGGAGCATTCCCAAATCTTAGAACACTTTGGATTTATGAATTGGATCAGCTAAGAGAGATCAGATTTGAGGACGGCAGCTCACCCCTGTTGGAAAAGATAGAAATAGGCGAGTGCAGGTTGGAATCTGGGATTACTGGTATCATTCACCTTCCAAAGCTCAAGGAGATTCCAATTAGATACGGAAGTAAAGTGGCTGGGCTTGGTCAGCTGGAGGGAGAAGTGAACGCACACCCAAATCGCCCCGTGCTGCTAATGTACAGTGACCGAAGGTATCACGACCTGGGGGCTGAAGCCGAAGGATCTTCTATAGAAGTGCAAACAGCAGATCCTGTTCCTGATGCCGAAGGATCAGTCACTGTAGCAGTGGAAGCAACGGATCCCCTTCCCGAGCAGGAGGGAGAGAGCTCGCAGTCGCAGGTGATCACGTTGACGACGAATGATAGCGAAGAGATAGGCACAGCTCAAGCTGGCTGA


Protein sequences

Name Description Sequence
Piz-t Piz-t [Oryza sativa Japonica Group].

MAETVLSMARSLVGSAISKAASAAADETSLLLGVEKDIWYIKDELKTMQAFLRAAELMKKKDELLKVWAEQIRDLSYDIEDSLDEFKVHIESQTLFRQLVKLRERHRIAIRIHNLKSRVEEVSSRNTRYSLVKPISSGTEIDMDSYAEDIRNQSARNVDEAELVGFSDSKKRLLEMIDTNANDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMIRQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINEIAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDMESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEALRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRPKVGMTTKDVGESYFNELINRSMIQRSRVGIAGKIKTCRIHDIIRDITVSISRQENFVLLPMGDGSDLVQENTRHIAFHGSMSCKTGLDWSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDVTFLITQKDFDRIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSEISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHMATKSCWSESIGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNGSTKEKCKILYAAIEKLSSLQSLHVDAVLFSGIIGTLECLDSISSPPPLLRTLVLDGILEEMPNWIEQLMHLKKIYLLSSKLKEGKTMLILGALPNLMVLHLYRNAYLGEKLVFKTGAFPNLRTLWIYELDQLREIRFEDGSSPLLEKIEIGECRLESGITGIIHLPKLKEIPIRYGSKVAGLGQLEGEVNAHPNRPVLLMYSDRRYHDLGAEAEGSSIEVQTADPVPDAEGSVTVAVEATDPLPEQEGESSQSQVITLTTNDSEEIGTAQAG

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
14-967 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GSAISKAASAAADETSLLLGVEKDIWYIKDELKTMQAFLRAAELMKKKDELLKVWAEQIRDLSYDIEDSLDEFKVHIESQTLFRQLVKLRERHRIAIRIHNLKSRVEEVSSRNTRYSLVKPISSGTEIDMDSYAEDIRNQSARNVDEAELVGFSDSKKRLLEMIDTNANDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMIRQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINEIAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDMESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEALRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRPKVGMTTKDVGESYFNELINRSMIQRSRVGIAGKIKTCRIHDIIRDITVSISRQENFVLLPMGDGSDLVQENTRHIAFHGSMSCKTGLDWSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDVTFLITQKDFDRIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSEISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHMATKSCWSESIGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNGSTKEKCKILYAAIEKLSSLQSLHVDAVLFSGIIGTLECLDSISSPPPLLRTLVLDGILEEMPNWIEQLMHLKKIYLLSSKLKEGKTMLILGALPNLMVLHLYRNAYLGEKLVFKTGAFPNLRTLWIYELDQLREIRFEDGSSPLLEKIEIGECRLESGITGIIHLPKLKEIPIRYGSKVAGLGQLEGEVNAHPNRPVLLMYSDRRY

HMMPanther: PTHR11017:SF127
14-967 PTHR11017:SF127,UNCHARACTERIZED

GSAISKAASAAADETSLLLGVEKDIWYIKDELKTMQAFLRAAELMKKKDELLKVWAEQIRDLSYDIEDSLDEFKVHIESQTLFRQLVKLRERHRIAIRIHNLKSRVEEVSSRNTRYSLVKPISSGTEIDMDSYAEDIRNQSARNVDEAELVGFSDSKKRLLEMIDTNANDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMIRQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINEIAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDMESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEALRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRPKVGMTTKDVGESYFNELINRSMIQRSRVGIAGKIKTCRIHDIIRDITVSISRQENFVLLPMGDGSDLVQENTRHIAFHGSMSCKTGLDWSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDVTFLITQKDFDRIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSEISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHMATKSCWSESIGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNGSTKEKCKILYAAIEKLSSLQSLHVDAVLFSGIIGTLECLDSISSPPPLLRTLVLDGILEEMPNWIEQLMHLKKIYLLSSKLKEGKTMLILGALPNLMVLHLYRNAYLGEKLVFKTGAFPNLRTLWIYELDQLREIRFEDGSSPLLEKIEIGECRLESGITGIIHLPKLKEIPIRYGSKVAGLGQLEGEVNAHPNRPVLLMYSDRRY

superfamily: SSF52540
151-405 SSF52540

RNQSARNVDEAELVGFSDSKKRLLEMIDTNANDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMIRQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINEIAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDMESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSEL

Gene3D: G3DSA:3.40.50.300
169-322 G3DSA:3.40.50.300

SKKRLLEMIDTNANDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMIRQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINEIAFPKNNKKGSRIVITTRNVDLAEK

HMMPfam: PF00931
IPR002182
174-462 NB-ARC,NBS
NB-ARC

LEMIDTNANDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMIRQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINEIAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDMESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEALRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRP

FPrintScan: PR00364
IPR000767
188-203 DISEASERSIST
Disease resistance protein

VICVVGMGGLGKTALS

FPrintScan: PR00364
IPR000767
273-287 DISEASERSIST
Disease resistance protein

ELKEKRYFVVLDDLW

FPrintScan: PR00364
IPR000767
372-386 DISEASERSIST
Disease resistance protein

CGRLPLAILTIGAVL

superfamily: SSF52058
500-936 SSF52058,LRR

RIHDIIRDITVSISRQENFVLLPMGDGSDLVQENTRHIAFHGSMSCKTGLDWSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDVTFLITQKDFDRIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSEISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHMATKSCWSESIGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNGSTKEKCKILYAAIEKLSSLQSLHVDAVLFSGIIGTLECLDSISSPPPLLRTLVLDGILEEMPNWIEQLMHLKKIYLLSSKLKEGKTMLILGALPNLMVLHLYRNAYLGEKLVFKTGAFPNLRTLWIYELDQLREIRFEDGSSPLLEKIEIGECRLESGITGIIHLPKLKEIPIRY

FPrintScan: PR00364
IPR000767
574-590 DISEASERSIST
Disease resistance protein

DQLRMLRVLDLEDVTFL

Gene3D: G3DSA:3.80.10.10
574-656 G3DSA:3.80.10.10

DQLRMLRVLDLEDVTFLITQKDFDRIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSEISKLQCLHTLR

Gene3D: G3DSA:3.80.10.10
716-934 G3DSA:3.80.10.10

KVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNGSTKEKCKILYAAIEKLSSLQSLHVDAVLFSGIIGTLECLDSISSPPPLLRTLVLDGILEEMPNWIEQLMHLKKIYLLSSKLKEGKTMLILGALPNLMVLHLYRNAYLGEKLVFKTGAFPNLRTLWIYELDQLREIRFEDGSSPLLEKIEIGECRLESGITGIIHLPKLKEIPI


Diseases

Disease Pathogen Avirulence gene
Rice blast disease Magnaporthe grisea

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox