PRGDB00061446 (Cre1)

From PRG Wiki
Jump to: navigation, search
Cre1
Gene Type Reference_R-Genes,_manually_curated
GenBank 22252945 (AY124651)
Gene Class CNL
Domain Type NBS, LRR, Others
Chromosome 2
Gene Species Aegilops tauschii

Comment?

Aegilops tauschii go35 NBS-LRR (go35) gene, complete cds.

DNA Sequence

ATGGATCCAATTACCATTGCTGCCGTAGGATGGAGCGTGGCCATGGTTGGTTGGGTCGCCTCGGCCACCATCTCTAAGCTCCTCGCCAAAGGCTTCGATTACCTCGAATATGACACAGCAAAGAAGCTGGCGCAACTTGAGCCAAAAATCTTGGTGCTGGAACGGGTCATGGAAGTTGTCGAGACGAGCCCATACAGGCCTCGTCTAGAGCAGCTGTTCAAGCGGCTTAAATATGCTTTCTATGAAGCCGAAGAAATCTTGGATGCTGTCGAGTATCACTGTCTAGAGAAGCAGATCAAAACAGGGAAACTACAGCCGGGCGGTGGCTCGTCTCTACCTAAAAAGGATCGTCTGAAAAAGAAGGAGAGTCGTATGTCAAATAAGAAGTTGGTAAAGAGCCTAAAGAAGATAGAAAACATTATAAATGAAGCACACCAGATTTTGGAGAAGCTTAACTTGTCAAGCATAAGTGATGGCAATATACGACACACAATGGTTGTCAATCCTACGACTACCGCAGTTTCCCCGCAAAAAGTTTTTGGTCGAGATAATGATCGCGACAAGATCATAGCAATGCTTCATGAAAAGGAAGGTGGTCTTGATCCAAGCACTAGCAAAGGTCTATGTTTTTCTGTAATTGGCATACATGGAGTCAGCGGGTCTGGGAAATCTACCCTTGCACAGTTTGTTTATGCCCACGAGAAAAATGACAAGCAAGACAACAAGGAAGACCATTTCGACCTTGTTATGTGGGTTCATGTCTCTCAGGATTTTAGTGTGTGGGGCATCTTCAAGGAGTTGTATGAGGCAGCTTCAGATCCTAAGGTTCCATGCCCTCAATTTAATAACTTGAATGCCTTGGAAGAAGAACTGGAGAGGAAACTAGATGGAAAGCGATTCCTTCTGGTACTGGATGATGTCTGGTGCAATGCGGATGTTGGTAACCAGGAGCTACCAAAGTTACTTTCTCCACTGAAGAAAGGAAAGAAAGGAAGCAAGATCCTAGTGACAACTCGAAGTAAATATGCACTACCGGATCTATGTCCTGGTGTGAGATATACTGCCATGCCGATAACTGAGGTTGATGATACCGCCTTCTTTGAGTTGTTCATGCATTATGCCCTCGAAGATGGCCAAGATCAAAGCATGTTCCAGAACATTGGGGTTGAGATTGCAAAAAAGCTGAAGGGGTCACCTTTAGCAGCTAGAACAGTGGGTGGAAATTTACGTCGACAGCAAGATGTTGACCATTGGAGAAGAGTCGGAGATCAAGACCTTTTCAAGGTATGGACGGGACCTCTGTGGTGGAGCTACTATCAGCTTGGTGAGCAGGCTAGGCGTTGCTTTGCTTACTGCAGTATTTTTCCTAGGAGACATCGCTTGTACCGTGATGAATTAGTTAGACTCTGGATGGCAGAAGGGTTCATAAGAAACACAGATGAAGGGGCGGATGCTGAAGACGTTGGTCTGGGAATATTTAATGAACTATTGTCGATATCATTTCTTCAACCAGGAGGCCAGGACTGGTACAATCATGGCAAGGAATACTATTTAGTTCATGATTTGCTGTATGATTTAGCAGGGGCAGTAGCTGGAACTGACTGCTTCAGAATTGACAATAACATGATCCAGAAAGGAGAAAGCTGGGCAAAAGATGTTCCCAGAGACGTTCGCCATCTTTTTGTTCAGAGTTATGATGCAGCATTGATTACAGGGAAGATTCTTGTATTGGAAAATTTACACACACTCGTCATTTATAGTGTTGGAGGGGATACAACAGTTGAGGAAATAGTCATCAAGAACATACTCAAGAGTCTGCCTAAACTGCGGGTACTAGCAATAGCTTTATGTCTGGAAAAGGATGGATTTATTTGTAGACCAAATATATTGTCTGTTCCAGAATCTATTAGTCAATTAAAACATCTACGATATCTTGCTTTCCGGACAGATATTGAATGCAGAGTAATTTTACCAAGCAGTCTAAACCAGCTTTACCAGATGCAACTGCTAGATTTTGGTGTCTGCATGAATTTGGTATTTTCCTGTGGTGATCTTATCAACTTGCGGCATGTATGCAGCGGTCCTGGATTGCAATTTTCAAACATCGGTAGGCTTGTCTCACTCCAAACAATCCCAGCATTCAAAGTAAGTCATGAACAAGGACATGAGGCAAAGCAGTTGAGGTACCTAAACAGGCTCAGCGGCGAACTGAGTATATATGGTCTCCAAAGTGTTGAAAGCAGAGAGGAAGCTCTTGCATTCGATCTAGCTGCCAAGAAACGGCTCGCAGAACTAACACTATCATTCGGTGGAAGTTCAGAAGTTGCAGCAGAGGTACTTGAGGGCCTTTGTCCTCCCGTGGGGCTTGTAACACTCGACATCCGTGACTACGATGGTTTGGTATACCCAAAGTGGATGGTGGGCAGGCAAAATGGCGCACCAGAGAAGCTGCAACAACTTGGTCTCTCAGGATGGAGCCAGCCAGGACCTGCTCCTGCACTGAAGGCTTTCAATCATCTTCGTTGCCTCAATCTGATGCACTGCAGCTGGAACGCCTTGCCATGCAATATGGAGCACCTCAGCTCGCTCGAAACAGTAATCATTATTAAATGTTTGAATATCCGGTCGCTTCCAACGCTGCCACAGTCTCTTACGTATTTTTGGCTCCTGAAGTGCGACGATGGGTTCATGGAGTCTTGTCAAACAGTTGGACATCCAAACTGGAAAAAGATTCAACACATCTGCAGGAAATATTTTAGTGAATGA


Protein sequences

Name Description Sequence
go35 NBS-LRR go35 NBS-LRR [Aegilops tauschii].

MDPITIAAVGWSVAMVGWVASATISKLLAKGFDYLEYDTAKKLAQLEPKILVLERVMEVVETSPYRPRLEQLFKRLKYAFYEAEEILDAVEYHCLEKQIKTGKLQPGGGSSLPKKDRLKKKESRMSNKKLVKSLKKIENIINEAHQILEKLNLSSISDGNIRHTMVVNPTTTAVSPQKVFGRDNDRDKIIAMLHEKEGGLDPSTSKGLCFSVIGIHGVSGSGKSTLAQFVYAHEKNDKQDNKEDHFDLVMWVHVSQDFSVWGIFKELYEAASDPKVPCPQFNNLNALEEELERKLDGKRFLLVLDDVWCNADVGNQELPKLLSPLKKGKKGSKILVTTRSKYALPDLCPGVRYTAMPITEVDDTAFFELFMHYALEDGQDQSMFQNIGVEIAKKLKGSPLAARTVGGNLRRQQDVDHWRRVGDQDLFKVWTGPLWWSYYQLGEQARRCFAYCSIFPRRHRLYRDELVRLWMAEGFIRNTDEGADAEDVGLGIFNELLSISFLQPGGQDWYNHGKEYYLVHDLLYDLAGAVAGTDCFRIDNNMIQKGESWAKDVPRDVRHLFVQSYDAALITGKILVLENLHTLVIYSVGGDTTVEEIVIKNILKSLPKLRVLAIALCLEKDGFICRPNILSVPESISQLKHLRYLAFRTDIECRVILPSSLNQLYQMQLLDFGVCMNLVFSCGDLINLRHVCSGPGLQFSNIGRLVSLQTIPAFKVSHEQGHEAKQLRYLNRLSGELSIYGLQSVESREEALAFDLAAKKRLAELTLSFGGSSEVAAEVLEGLCPPVGLVTLDIRDYDGLVYPKWMVGRQNGAPEKLQQLGLSGWSQPGPAPALKAFNHLRCLNLMHCSWNALPCNMEHLSSLETVIIIKCLNIRSLPTLPQSLTYFWLLKCDDGFMESCQTVGHPNWKKIQHICRKYFSE

Domains

Domain Start-End Description Sequence

Coil: coil
134-155 coiled-coil

LKKIENIINEAHQILEKLNLSS

superfamily: SSF52540
162-431 P-loop containing nucleoside triphosphate hydrolases

RHTMVVNPTTTAVSPQKVFGRDNDRDKIIAMLHEKEGGLDPSTSKGLCFSVIGIHGVSGSGKSTLAQFVYAHEKNDKQDNKEDHFDLVMWVHVSQDFSVWGIFKELYEAASDPKVPCPQFNNLNALEEELERKLDGKRFLLVLDDVWCNADVGNQELPKLLSPLKKGKKGSKILVTTRSKYALPDLCPGVRYTAMPITEVDDTAFFELFMHYALEDGQDQSMFQNIGVEIAKKLKGSPLAARTVGGNLRRQQDVDHWRRVGDQDLFKVWT

Gene3D: G3DSA:3.40.50.300
180-346 no description

FGRDNDRDKIIAMLHEKEGGLDPSTSKGLCFSVIGIHGVSGSGKSTLAQFVYAHEKNDKQDNKEDHFDLVMWVHVSQDFSVWGIFKELYEAASDPKVPCPQFNNLNALEEELERKLDGKRFLLVLDDVWCNADVGNQELPKLLSPLKKGKKGSKILVTTRSKYALPD

HMMPfam: PF00931
IPR002182
210-480 NB-ARC,NBS
NB-ARC

FSVIGIHGVSGSGKSTLAQFVYAHEKNDKQDNKEDHFDLVMWVHVSQDFSVWGIFKELYEAASDPKVPCPQFNNLNALEEELERKLDGKRFLLVLDDVWCNADVGNQELPKLLSPLKKGKKGSKILVTTRSKYALPDLCPGVRYTAMPITEVDDTAFFELFMHYALEDGQDQSMFQNIGVEIAKKLKGSPLAARTVGGNLRRQQDVDHWRRVGDQDLFKVWTGPLWWSYYQLGEQARRCFAYCSIFPRRHRLYRDELVRLWMAEGFIRNTD

Seg: seg
211-224 seg

SVIGIHGVSGSGKS

FPrintScan: PR00364
IPR000767
212-227 DISEASERSIST
Disease resistance protein

VIGIHGVSGSGKSTLA

Seg: seg
282-292 seg

NNLNALEEELE

FPrintScan: PR00364
IPR000767
294-308 DISEASERSIST
Disease resistance protein

KLDGKRFLLVLDDVW

Seg: seg
318-333 seg

LPKLLSPLKKGKKGSK

FPrintScan: PR00364
IPR000767
395-409 DISEASERSIST
Disease resistance protein

LKGSPLAARTVGGNL

superfamily: SSF52058
506-883 L domain-like,LRR

GQDWYNHGKEYYLVHDLLYDLAGAVAGTDCFRIDNNMIQKGESWAKDVPRDVRHLFVQSYDAALITGKILVLENLHTLVIYSVGGDTTVEEIVIKNILKSLPKLRVLAIALCLEKDGFICRPNILSVPESISQLKHLRYLAFRTDIECRVILPSSLNQLYQMQLLDFGVCMNLVFSCGDLINLRHVCSGPGLQFSNIGRLVSLQTIPAFKVSHEQGHEAKQLRYLNRLSGELSIYGLQSVESREEALAFDLAAKKRLAELTLSFGGSSEVAAEVLEGLCPPVGLVTLDIRDYDGLVYPKWMVGRQNGAPEKLQQLGLSGWSQPGPAPALKAFNHLRCLNLMHCSWNALPCNMEHLSSLETVIIIKCLNIRSLPTLPQS

HMMPanther: PTHR23155
629-904 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ILSVPESISQLKHLRYLAFRTDIECRVILPSSLNQLYQMQLLDFGVCMNLVFSCGDLINLRHVCSGPGLQFSNIGRLVSLQTIPAFKVSHEQGHEAKQLRYLNRLSGELSIYGLQSVESREEALAFDLAAKKRLAELTLSFGGSSEVAAEVLEGLCPPVGLVTLDIRDYDGLVYPKWMVGRQNGAPEKLQQLGLSGWSQPGPAPALKAFNHLRCLNLMHCSWNALPCNMEHLSSLETVIIIKCLNIRSLPTLPQSLTYFWLLKCDDGFMESCQTVG

HMMPanther: PTHR23155:SF143
629-904 OS04G0325300 PROTEIN (FRAGMENT),OS04G0325300 PROTEIN (FRAGMENT)

ILSVPESISQLKHLRYLAFRTDIECRVILPSSLNQLYQMQLLDFGVCMNLVFSCGDLINLRHVCSGPGLQFSNIGRLVSLQTIPAFKVSHEQGHEAKQLRYLNRLSGELSIYGLQSVESREEALAFDLAAKKRLAELTLSFGGSSEVAAEVLEGLCPPVGLVTLDIRDYDGLVYPKWMVGRQNGAPEKLQQLGLSGWSQPGPAPALKAFNHLRCLNLMHCSWNALPCNMEHLSSLETVIIIKCLNIRSLPTLPQSLTYFWLLKCDDGFMESCQTVG

FPrintScan: PR00364
IPR000767
662-678 DISEASERSIST
Disease resistance protein

NQLYQMQLLDFGVCMNL

Gene3D: G3DSA:3.80.10.10
795-892 no description

RDYDGLVYPKWMVGRQNGAPEKLQQLGLSGWSQPGPAPALKAFNHLRCLNLMHCSWNALPCNMEHLSSLETVIIIKCLNIRSLPTLPQSLTYFWLLKC


Diseases

Disease Pathogen Avirulence gene
Cereal cyst nematode Heterodera avenae

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox