PRGDB00061447 (RPP27)

From PRG Wiki
Revision as of 22:32, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
RPP27
Gene Type Reference_R-Genes,_manually_curated
GenBank 42516773 (AJ585978)
Gene Class RLP
Domain Type LRR
Chromosome 1
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana rpp27 gene, exons 1-6.

DNA Sequence

ATGAAGACTAATTTTGTTATTCTACTTCTTCTCCTCTGTGTTTTTGCGATCAGCCCTAGTCAACAAGAAGAGATCAATCAACATAATCCAGGGATATATCATCAAAAGCTGCTATACAAGGTCCAACAATGGAGAACATCTTTGAAAGAATCAAATTCTGTAGAACTCAAGCTATCTTTAGCAGCCATTGTGGCTGGAGTGTTATACTTCCTTGCTGCCTTAATCTCGAGCGCATGTGGAATCGGCAGTGGAGGTTTATTCATTCCAATCACGACTCTAGTTTCACGGCTAGACTTGAAAACAGGGAAGCGTTTCTTGGGCCAATACTTGATATGGGTGATATTATTGTTGGGGCAGCTCCATGAATGCAAAAGCTGCATTGAGAAAGAAAGAGTAGCTTTGTTGGATTTTAAGAAATATTGGATGTCCATTACGCAAGAATCGGACTTGGACTATGTTTTCCCTACTTGGAATAATGACACAAAGAGCGATTGTTGCCAGTGGGAGAGCATTATGTGCAATCCTACAAGTGGGCGGCTTATCAGGCTTCACGTTGGTGCTTCGAATTTAAAAGAGAATTCTCTACTAAATATTTCTTTACTGCATCCCTTTGAAGAGGTTCGAAGTCTAGAATTATCAGCTGGGCTCAATGGCTTCGTTGATAATGTTGAAGGTTATAAAAGCTTAAGGAAATTAAAAAATTTGGAGATTCTGGATCTCTCTTATAATAATAGATTCAACAACAACATACTTCCATTTATTAATGCTGCTACGTCACTTACAAGCCTTTCTCTTCAAAATAACTCCATGGAAGGCCCTTTCCCTTTTGAAGAAATAAAAGACTTGACAAACTTGAAACTATTGGATCTTAGTAGAAACATACTAAAAGGCCCCATGCAAGGGTTGACTCATCTGAAAAAGCTAAAAGCTTTGGATCTAAGTAACAATGTTTTTTCGAGCATAATGGAATTGCAAGTAGTTTGTGAAATGAAGAATTTGTGGGAGCTTGATCTTCGTGAAAATAAATTTGTAGGTCAGCTTCCTCTTTGTTTAGGTAGATTAAACAAGCTAAGGGTTCTTGATTTGTCATCCAACCAGCTAAATGGAAATCTACCATCTACTTTCAACAGACTCGAGTCCCTTGAATATCTATCATTATTAGATAACAACTTCACCGGCTTCTTCTCATTTGATCCACTCGCCAACCTCACAAAGCTTAAGGTGTTCAAACTTTCATCAACATCAGATATGTTGCAAATCAAGACAGAGAGTGAGCCAAAATATCAATTTCAACTAAGTGTTGTTGTAATAAGAGTTTGCAGCTTGGAGAAAATCCCTTCCTTTCTCGAGTACCAGAAAAACTTGCGTCTAGTTGATCTATCCAACAACAGATTATCTGGAAACCTACCTACATGGTTGTTGGCAAACAATCCGGAACTTAAAGTATTACAGTTGCAGGATAATTTATTTACCATCTTCCAGATGCCTGCTACAATAGTGCATGAGTTGCAGTTCTTGGATTTTTCAGTGAATGATATTAGTGGACTGCTCCCTGATAATATCGGTTATGCGCTTCCGAATCTGTTACGAATGAACGGCTCAAGAAATGGGTTTCAAGGGCATTTACCATCTTCTATGGGTGAGATGGTAAACATTACATCCCTTGATCTATCTTATAATAACTTCTCCGGGAAGCTACCTAGACGCTTTGTCACTGGTTGTTTTTCACTAAAACACTTGAAGCTCTCCCACAACAATTTTAGTGGCCATTTTCTTCCAAGAGAAACAAGCTTTACTTCCCTGGAAGAGTTGAGAGTTGATAGCAACTCATTCACTGGGAAGATCGGAGTTGGTTTGCTTAGCTCCAACACTACGTTATCAGTTCTTGACATGTCCAACAATTTTCTAACGGGTGATATTCCAAGCTGGATGTCTAACTTATCTGGTTTAACTATCTTGTCGATATCAAACAATTTTTTAGAAGGTACGATACCACCATCTTTGCTAGCCATTGGCTTTCTTTCTCTCATCGACCTATCGGGAAACTTATTATCTGGATCCTTACCGTCACGTGTTGGTGGGGAGTTTGGGATAAAATTGTTCCTACACGACAACATGCTCACGGGGCCGATTCCAGACACGTTGTTGGAAAAGGTCCAAATACTTGATTTACGGTACAATCAACTTTCTGGGAGTATTCCACAATTTGTCAATACCGAGAGCATATATATTCTTTTAATGAAGGGAAACAACTTAACAGGATCTATGTCAAGGCAGCTCTGTGATTTGAGAAATATCAGACTTTTAGATCTTTCAGATAACAAGCTCAATGGCTTCATACCTTCATGTCTATATAATTTATCATTTGGACCAGAGGATACAAATTCATATGTAGGTACAGCCATAACGAAGATTACTCCGTTCAAGTTTTACGAATCCACATTTGTGGTAGAGGATTTTGTGGTAATATCCTCTAGTTTTCAAGAAATTGAAATCAAATTTTCAATGAAGCGAAGGTATGATTCTTATTTTGGAGCAACTGAATTCAACAATGACGTACTTGATTATATGTATGGAATGGACCTATCAAGCAATGAGTTAAGTGGGGTTATCCCAGCAGAGCTTGGAAGTCTCTCAAAGCTACGAGTCATGAATTTATCTTGCAACTTCTTGTCCAGTTCAATACCATCTAGCTTCTCCAATCTCAAGGATATTGAGAGCCTTGACCTTTCGCATAACATGTTACAAGGAAGTATTCCTCAACAACTAACCAACCTTTCTTCTCTTGTTGTCTTTGATGTGTCTTACAATAATTTATCCGGAATCATTCCCCAAGGAAGGCAGTTTAATACCTTTGACGAGAAAAGCTACTTGGGAAATCCTCTTCTTTGTGGACCACCGACCAATAGAAGTTGTGATGCTAAGAAGACCTCAGATGAATCAGAAAATGGAGGAGAAGAAGAAGATGATGAAGCTCCTGTTGATATGTTGGCCTTCTATTTTAGTAGTGCTTCGACTTATGTAACTACATTGATAGGCATTTTTATACTTATGTGCTTTGATTGTCCTTTGCGTCGAGCATGGCTCCGCATTGTCGATGCTTCCATCGCCTCAGTCAAAAGTATGTTGCCTTAA


Protein sequences

Name Description Sequence
RPP27 protein RPP27 protein [Arabidopsis thaliana].

MKTNFVILLLLLCVFAISPSQQEEINQHNPGIYHQKLLYKVQQWRTSLKESNSVELKLSLAAIVAGVLYFLAALISSACGIGSGGLFIPITTLVSRLDLKTGKRFLGQYLIWVILLLGQLHECKSCIEKERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCNPTSGRLIRLHVGASNLKENSLLNISLLHPFEEVRSLELSAGLNGFVDNVEGYKSLRKLKNLEILDLSYNNRFNNNILPFINAATSLTSLSLQNNSMEGPFPFEEIKDLTNLKLLDLSRNILKGPMQGLTHLKKLKALDLSNNVFSSIMELQVVCEMKNLWELDLRENKFVGQLPLCLGRLNKLRVLDLSSNQLNGNLPSTFNRLESLEYLSLLDNNFTGFFSFDPLANLTKLKVFKLSSTSDMLQIKTESEPKYQFQLSVVVIRVCSLEKIPSFLEYQKNLRLVDLSNNRLSGNLPTWLLANNPELKVLQLQDNLFTIFQMPATIVHELQFLDFSVNDISGLLPDNIGYALPNLLRMNGSRNGFQGHLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHNNFSGHFLPRETSFTSLEELRVDSNSFTGKIGVGLLSSNTTLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLLSGSLPSRVGGEFGIKLFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLSFGPEDTNSYVGTAITKITPFKFYESTFVVEDFVVISSSFQEIEIKFSMKRRYDSYFGATEFNNDVLDYMYGMDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQGRQFNTFDEKSYLGNPLLCGPPTNRSCDAKKTSDESENGGEEEDDEAPVDMLAFYFSSASTYVTTLIGIFILMCFDCPLRRAWLRIVDASIASVKSMLP


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF914
90-1028 PTHR24420:SF914

ITTLVSRLDLKTGKRFLGQYLIWVILLLGQLHECKSCIEKERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCNPTSGRLIRLHVGASNLKENSLLNISLLHPFEEVRSLELSAGLNGFVDNVEGYKSLRKLKNLEILDLSYNNRFNNNILPFINAATSLTSLSLQNNSMEGPFPFEEIKDLTNLKLLDLSRNILKGPMQGLTHLKKLKALDLSNNVFSSIMELQVVCEMKNLWELDLRENKFVGQLPLCLGRLNKLRVLDLSSNQLNGNLPSTFNRLESLEYLSLLDNNFTGFFSFDPLANLTKLKVFKLSSTSDMLQIKTESEPKYQFQLSVVVIRVCSLEKIPSFLEYQKNLRLVDLSNNRLSGNLPTWLLANNPELKVLQLQDNLFTIFQMPATIVHELQFLDFSVNDISGLLPDNIGYALPNLLRMNGSRNGFQGHLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHNNFSGHFLPRETSFTSLEELRVDSNSFTGKIGVGLLSSNTTLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLLSGSLPSRVGGEFGIKLFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLSFGPEDTNSYVGTAITKITPFKFYESTFVVEDFVVISSSFQEIEIKFSMKRRYDSYFGATEFNNDVLDYMYGMDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQGRQFNTFDEKSYLGNPLLCGPPTNRSCDAKKTSDESENGGEEEDDEAPVDMLAFYFSSASTYVTTLIGIFILMCFDCPLRRAW

HMMPanther: PTHR24420
90-1028 PTHR24420,FAMILY NOT NAMED

ITTLVSRLDLKTGKRFLGQYLIWVILLLGQLHECKSCIEKERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCNPTSGRLIRLHVGASNLKENSLLNISLLHPFEEVRSLELSAGLNGFVDNVEGYKSLRKLKNLEILDLSYNNRFNNNILPFINAATSLTSLSLQNNSMEGPFPFEEIKDLTNLKLLDLSRNILKGPMQGLTHLKKLKALDLSNNVFSSIMELQVVCEMKNLWELDLRENKFVGQLPLCLGRLNKLRVLDLSSNQLNGNLPSTFNRLESLEYLSLLDNNFTGFFSFDPLANLTKLKVFKLSSTSDMLQIKTESEPKYQFQLSVVVIRVCSLEKIPSFLEYQKNLRLVDLSNNRLSGNLPTWLLANNPELKVLQLQDNLFTIFQMPATIVHELQFLDFSVNDISGLLPDNIGYALPNLLRMNGSRNGFQGHLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHNNFSGHFLPRETSFTSLEELRVDSNSFTGKIGVGLLSSNTTLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLLSGSLPSRVGGEFGIKLFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLSFGPEDTNSYVGTAITKITPFKFYESTFVVEDFVVISSSFQEIEIKFSMKRRYDSYFGATEFNNDVLDYMYGMDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQGRQFNTFDEKSYLGNPLLCGPPTNRSCDAKKTSDESENGGEEEDDEAPVDMLAFYFSSASTYVTTLIGIFILMCFDCPLRRAW

superfamily: SSF52058
124-475 SSF52058,LRR

KSCIEKERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCNPTSGRLIRLHVGASNLKENSLLNISLLHPFEEVRSLELSAGLNGFVDNVEGYKSLRKLKNLEILDLSYNNRFNNNILPFINAATSLTSLSLQNNSMEGPFPFEEIKDLTNLKLLDLSRNILKGPMQGLTHLKKLKALDLSNNVFSSIMELQVVCEMKNLWELDLRENKFVGQLPLCLGRLNKLRVLDLSSNQLNGNLPSTFNRLESLEYLSLLDNNFTGFFSFDPLANLTKLKVFKLSSTSDMLQIKTESEPKYQFQLSVVVIRVCSLEKIPSFLEYQKNLRLVDLSNNRLSGNLPTWLLA

Gene3D: G3DSA:3.80.10.10
127-414 G3DSA:3.80.10.10

IEKERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCNPTSGRLIRLHVGASNLKENSLLNISLLHPFEEVRSLELSAGLNGFVDNVEGYKSLRKLKNLEILDLSYNNRFNNNILPFINAATSLTSLSLQNNSMEGPFPFEEIKDLTNLKLLDLSRNILKGPMQGLTHLKKLKALDLSNNVFSSIMELQVVCEMKNLWELDLRENKFVGQLPLCLGRLNKLRVLDLSSNQLNGNLPSTFNRLESLEYLSLLDNNFTGFFSFDPLANLTKLKVFKLSST

HMMPfam: PF08263
IPR013210
129-174 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

KERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCN

ProfileScan: PS51450
IPR001611
234-255 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEILDLSYNNRFNNNILPFIN

ProfileScan: PS51450
IPR001611
259-280 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTSLSLQNNSMEGPFPFEEIK

ProfileScan: PS51450
IPR001611
284-306 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKLLDLSRNILKGPMQGLTHLK

ProfileScan: PS51450
IPR001611
307-328 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLKALDLSNNVFSSIMELQVVC

ProfileScan: PS51450
IPR001611
356-378 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRVLDLSSNQLNGNLPSTFNRL

HMMPfam: PF00560
IPR001611
356-377 LRR_1
Leucine-rich repeat

KLRVLDLSSNQLNGNLPSTFNR

FPrintScan: PR00019
357-370 LEURICHRPT,Leucine-rich repeat signature

LRVLDLSSNQLNGN

ProfileScan: PS51450
IPR001611
380-401 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEYLSLLDNNFTGFFSFDPLA

Gene3D: G3DSA:3.80.10.10
442-581 G3DSA:3.80.10.10

LEKIPSFLEYQKNLRLVDLSNNRLSGNLPTWLLANNPELKVLQLQDNLFTIFQMPATIVHELQFLDFSVNDISGLLPDNIGYALPNLLRMNGSRNGFQGHLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLK

HMMPfam: PF00560
IPR001611
454-476 LRR_1
Leucine-rich repeat

NLRLVDLSNNRLSGNLPTWLLAN

ProfileScan: PS51450
IPR001611
454-476 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRLVDLSNNRLSGNLPTWLLAN

ProfileScan: PS51450
IPR001611
502-523 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELQFLDFSVNDISGLLPDNIGY

superfamily: SSF52047
541-988 SSF52047,LRR

HLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHNNFSGHFLPRETSFTSLEELRVDSNSFTGKIGVGLLSSNTTLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLLSGSLPSRVGGEFGIKLFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLSFGPEDTNSYVGTAITKITPFKFYESTFVVEDFVVISSSFQEIEIKFSMKRRYDSYFGATEFNNDVLDYMYGMDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQGRQFNTFDEKSYLGNPLLCGPPTNRSCDAKKTSDESENGGEEE

ProfileScan: PS51450
IPR001611
551-572 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NITSLDLSYNNFSGKLPRRFVT

HMMPfam: PF00560
IPR001611
551-570 LRR_1
Leucine-rich repeat

NITSLDLSYNNFSGKLPRRF

ProfileScan: PS51450
IPR001611
576-599 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKHLKLSHNNFSGHFLPRETSFT

Gene3D: G3DSA:3.80.10.10
582-787 G3DSA:3.80.10.10

LSHNNFSGHFLPRETSFTSLEELRVDSNSFTGKIGVGLLSSNTTLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLLSGSLPSRVGGEFGIKLFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNL

ProfileScan: PS51450
IPR001611
625-647 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLSVLDMSNNFLTGDIPSWMSNL

HMMPfam: PF00560
IPR001611
626-647 LRR_1
Leucine-rich repeat

LSVLDMSNNFLTGDIPSWMSNL

ProfileScan: PS51450
IPR001611
649-670 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLTILSISNNFLEGTIPPSLLA

HMMPfam: PF00560
IPR001611
650-669 LRR_1
Leucine-rich repeat

LTILSISNNFLEGTIPPSLL

ProfileScan: PS51450
IPR001611
718-740 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KVQILDLRYNQLSGSIPQFVNTE

HMMPfam: PF00560
IPR001611
719-736 LRR_1
Leucine-rich repeat

VQILDLRYNQLSGSIPQF

ProfileScan: PS51450
IPR001611
765-786 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NIRLLDLSDNKLNGFIPSCLYN

Gene3D: G3DSA:3.80.10.10
860-966 G3DSA:3.80.10.10

MDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQGRQFNTFDEKSYLGNPLLCGP

HMMPfam: PF13855
861-915 LRR_8,Leucine rich repeat

DLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNML

ProfileScan: PS51450
IPR001611
880-901 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRVMNLSCNFLSSSIPSSFSN

FPrintScan: PR00019
902-915 LEURICHRPT,Leucine-rich repeat signature

LKDIESLDLSHNML

ProfileScan: PS51450
IPR001611
904-927 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DIESLDLSHNMLQGSIPQQLTNLS

ProfileScan: PS51450
IPR001611
928-949 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLVVFDVSYNNLSGIIPQGRQF


Diseases

Disease Pathogen Avirulence gene
Downy mildew

List of References

Mahmut Tör, Duncan Brown, Abigail Cooper, Alison Woods-Tör, Kimmen Sjölander, Jonathan D G Jones, Eric B Holub
Arabidopsis downy mildew resistance gene RPP27 encodes a receptor-like protein similar to CLAVATA2 and tomato Cf-9.
Plant Physiol.: 2004, 135(2);1100-12
PubMed:15155873 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox