PRGDB00061448 (Xa26)

From PRG Wiki
Revision as of 22:32, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Xa26
Gene Type Reference_R-Genes,_manually_curated
GenBank 90018762 (DQ426646)
Gene Class RLK
Domain Type Ser-Thr Kinase, LRR
Chromosome 11
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) bacterial blight resistance protein XA26 (Xa26) gene, complete cds.

DNA Sequence

ATGGCTCTTGTTCGATTGCCAGTATGGATTTTCGTTGCGGCGTTGTTGATCGCTTCGTCCAGTACTGTGCCTTGTGCTTCCTCTCTAGGTCCGATCGCCAGCAAGAGTAACAGCAGCGACACCGACCTCGCTGCATTGCTGGCCTTCAAAGCCCAGCTCTCCGATCCTAACAACATCCTTGCCGGCAATTGGACCACCGGAACGCCGTTCTGCCGGTGGGTGGGTGTCTCGTGCAGCAGCCACCGCCGCCGCCGGCAGCGCGTCACCGCCCTGGAACTGCCAAACGTTCCTCTCCAAGGAGAGCTCAGCTCTCACCTTGGTAACATTTCTTTTCTCTTCATCCTCAACCTCACCAACACCGGCCTCACTGGCTCGGTGCCCAACAAAATAGGAAGGCTGCGTCGCCTCGAGCTCCTTGATCTCGGCCACAATGCCATGTCAGGTGGCATCCCTGCAGCCATAGGGAACCTCACGAGGCTTCAGCTACTTAATCTACAGTTTAACCAGCTATACGGTCCAATCCCAGCAGAGCTGCAGGGGTTGCACAGTCTTGGCAGCATGAATCTCCGTCACAATTACCTCACTGGATCGATTCCGGACGATCTGTTCAACAACACGCCTTTGCTAACTTATCTCAACGTTGGTAACAATAGCCTGTCAGGACTGATACCGGGTTGCATCGGTTCCTTGCCAATCCTCCAACACCTTAACTTTCAGGCCAATAACTTAACTGGGGCGGTGCCACCAGCCATCTTCAACATGTCTAAATTAAGTACCATTTCTCTTATATCGAATGGTTTAACTGGCCCTATCCCTGGTAATACAAGTTTCAGCCTCCCAGTTCTACGATGGTTCGCCATCAGTAAAAACAATTTCTTTGGTCAGATTCCACTGGGGCTCGCAGCGTGTCCATACCTCCAAGTTATTGCCATGCCTTATAATTTATTCGAGGGTGTTTTGCCACCATGGCTGGGCAGGTTGACCAATCTTGATGCCATCTCCTTGGGTGGGAATAACTTTGATGCTGGCCCCATCCCTACTGAACTTAGCAACCTCACCATGCTGACAGTCTTAGATTTGACGACGTGCAACCTAACAGGAAACATCCCTGCAGATATTGGGCACCTAGGCCAACTTTCATGGTTGCATCTTGCGATGAATCAACTAACAGGACCTATTCCTGCTTCTCTTGGCAACCTTTCATCGTTGGCAATCCTGCTACTGAAAGGAAACTTGCTGGATGGATCATTACCATCGACAGTTGATAGCATGAACTCACTAACGGCAGTTGATGTTACTGAAAACAATCTACACGGGGATCTCAACTTCCTTTCTACTGTTTCCAATTGTAGGAAGCTTTCTACCCTCCAAATGGACCTGAATTATATCACCGGAATCCTCCCAGACTATGTTGGGAACCTGTCGTCACAGCTGAAATGGTTCACGTTATCTAACAACAAGTTAACTGGCACGCTTCCAGCTACCATTTCAAATTTAACTGCTCTTGAGGTGATAGATCTTTCACATAACCAACTGCGCAATGCAATTCCAGAATCAATCATGACGATTGAGAATCTCCAATGGCTTGACCTAAGTGGAAATAGCTTGTCTGGCTTCATCCCATCGAATACTGCACTTCTAAGGAACATTGTAAAACTGTTCCTTGAAAGCAACGAAATTTCTGGCTCCATACCAAAGGACATGAGGAACCTCACTAATCTAGAGCACCTTCTATTGTCTGATAACAAATTAACGTCAACTATACCACCAAGCTTATTTCATCTTGATAAAATCGTCAGGCTAGATCTTTCTCGAAACTTCTTGAGTGGTGCACTGCCGGTTGATGTAGGGTATTTGAAGCAAATTACCATCATGGATCTCTCTGACAACCACTTTTCTGGTAGAATCCCATATTCGATAGGACAACTTCAGATGTTAACACACCTGAATCTATCAGCTAACGGATTCTATGATTCTGTTCCAGACTCTTTTGGTAATTTAACTGGCTTGCAAACTTTGGACATATCCCATAACAGTATTTCTGGTACCATCCCAAACTACTTGGCTAATTTTACGACCCTTGTTAGCTTGAACCTATCTTTCAACAAACTACATGGTCAAATACCGGAAGGAGGTGTCTTTGCAAACATCACTTTACAATACTTGGAAGGAAACTCAGGGCTATGTGGTGCTGCCCGTTTAGGATTCCCACCATGCCAAACCACCTCCCCCAACAGAAATAATGGTCACATGCTAAAATATTTGCTACCTACTATAATCATAGTAGTTGGAATTGTAGCTTGTTGCCTGTATGTAGTGATTAGAAAGAAAGCTAACCATCAAAATACTTCTGCTGGTAAGGCTGACCTTATCAGCCATCAATTGCTCTCCTATCATGAGCTTCTTCGTGCAACCGATGATTTCAGCGATGATAGCATGTTGGGCTTCGGAAGCTTTGGAAAAGTTTTTAGGGGACGATTGAGCAACGGTATGGTGGTTGCCATAAAAGTTATACACCAGCATCTGGAACATGCCATGAGAAGCTTTGACACCGAGTGTCGTGTGCTCCGAATGGCTCGACATCGCAACCTGATAAAGATTCTGAACACTTGTTCCAACCTGGACTTCAGAGCACTGGTACTTCAGTACATGCCCAAGGGTAGCTTAGAAGCACTCCTGCACTCAGAACAAGGGAAGCAATTAGGCTTTCTCGAGAGGTTGGATATTATGCTAGATGTGTCAATGGCAATGGAATACCTGCATCATGAGCACTATGAGGTGGTCTTACACTGCGATTTGAAGCCTAGCAACGTACTATTTGACGATGATATGACGGCACATGTGGCAGACTTTGGTATTGCAAGGTTGTTGTTAGGTGATGACAACTCCATGATCTCAGCTAGCATGCCAGGAACAGTTGGGTACATGGCACCAGAGTATGGGACTCTAGGAAAAGCATCACGGAAGAGTGATGTGTTCAGTTACGGCATCATGCTGCTTGAAGTGTTCACTGCGAAGAGACCCACAGATGCTATGTTTGTGGGAGAACTGAACATCAGGCAGTGGGTTCAACAGGCGTTTCCTGCAGAGCTTGTCCATGTGGTGGACTGCCAACTTCTACAGGATGGCTCTTCTTCTTCTTCAAGTAACATGCATGACTTCCTTGTGCCAGTGTTCGAGCTGGGCTTGCTCTGTTCGGCTGACTCCCCCGAGCAAAGGATGGCGATGAGCGATGTGGTCTTGACACTGAACAAGATTAGAAAGGACTATGTCAAATTGATGGCAACCACAGTGAGCGTTGTGCAGCAGTGA


Protein sequences

Name Description Sequence
bacterial blight resistance protein XA26 bacterial blight resistance protein XA26 [Oryza sativa Japonica Group].

MALVRLPVWIFVAALLIASSSTVPCASSLGPIASKSNSSDTDLAALLAFKAQLSDPNNILAGNWTTGTPFCRWVGVSCSSHRRRRQRVTALELPNVPLQGELSSHLGNISFLFILNLTNTGLTGSVPNKIGRLRRLELLDLGHNAMSGGIPAAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTPLLTYLNVGNNSLSGLIPGCIGSLPILQHLNFQANNLTGAVPPAIFNMSKLSTISLISNGLTGPIPGNTSFSLPVLRWFAISKNNFFGQIPLGLAACPYLQVIAMPYNLFEGVLPPWLGRLTNLDAISLGGNNFDAGPIPTELSNLTMLTVLDLTTCNLTGNIPADIGHLGQLSWLHLAMNQLTGPIPASLGNLSSLAILLLKGNLLDGSLPSTVDSMNSLTAVDVTENNLHGDLNFLSTVSNCRKLSTLQMDLNYITGILPDYVGNLSSQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQLRNAIPESIMTIENLQWLDLSGNSLSGFIPSNTALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNKLTSTIPPSLFHLDKIVRLDLSRNFLSGALPVDVGYLKQITIMDLSDNHFSGRIPYSIGQLQMLTHLNLSANGFYDSVPDSFGNLTGLQTLDISHNSISGTIPNYLANFTTLVSLNLSFNKLHGQIPEGGVFANITLQYLEGNSGLCGAARLGFPPCQTTSPNRNNGHMLKYLLPTIIIVVGIVACCLYVVIRKKANHQNTSAGKADLISHQLLSYHELLRATDDFSDDSMLGFGSFGKVFRGRLSNGMVVAIKVIHQHLEHAMRSFDTECRVLRMARHRNLIKILNTCSNLDFRALVLQYMPKGSLEALLHSEQGKQLGFLERLDIMLDVSMAMEYLHHEHYEVVLHCDLKPSNVLFDDDMTAHVADFGIARLLLGDDNSMISASMPGTVGYMAPEYGTLGKASRKSDVFSYGIMLLEVFTAKRPTDAMFVGELNIRQWVQQAFPAELVHVVDCQLLQDGSSSSSSNMHDFLVPVFELGLLCSADSPEQRMAMSDVVLTLNKIRKDYVKLMATTVSVVQQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-1092 FAMILY NOT NAMED,FAMILY NOT NAMED

MALVRLPVWIFVAALLIASSSTVPCASSLGPIASKSNSSDTDLAALLAFKAQLSDPNNILAGNWTTGTPFCRWVGVSCSSHRRRRQRVTALELPNVPLQGELSSHLGNISFLFILNLTNTGLTGSVPNKIGRLRRLELLDLGHNAMSGGIPAAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTPLLTYLNVGNNSLSGLIPGCIGSLPILQHLNFQANNLTGAVPPAIFNMSKLSTISLISNGLTGPIPGNTSFSLPVLRWFAISKNNFFGQIPLGLAACPYLQVIAMPYNLFEGVLPPWLGRLTNLDAISLGGNNFDAGPIPTELSNLTMLTVLDLTTCNLTGNIPADIGHLGQLSWLHLAMNQLTGPIPASLGNLSSLAILLLKGNLLDGSLPSTVDSMNSLTAVDVTENNLHGDLNFLSTVSNCRKLSTLQMDLNYITGILPDYVGNLSSQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQLRNAIPESIMTIENLQWLDLSGNSLSGFIPSNTALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNKLTSTIPPSLFHLDKIVRLDLSRNFLSGALPVDVGYLKQITIMDLSDNHFSGRIPYSIGQLQMLTHLNLSANGFYDSVPDSFGNLTGLQTLDISHNSISGTIPNYLANFTTLVSLNLSFNKLHGQIPEGGVFANITLQYLEGNSGLCGAARLGFPPCQTTSPNRNNGHMLKYLLPTIIIVVGIVACCLYVVIRKKANHQNTSAGKADLISHQLLSYHELLRATDDFSDDSMLGFGSFGKVFRGRLSNGMVVAIKVIHQHLEHAMRSFDTECRVLRMARHRNLIKILNTCSNLDFRALVLQYMPKGSLEALLHSEQGKQLGFLERLDIMLDVSMAMEYLHHEHYEVVLHCDLKPSNVLFDDDMTAHVADFGIARLLLGDDNSMISASMPGTVGYMAPEYGTLGKASRKSDVFSYGIMLLEVFTAKRPTDAMFVGELNIRQWVQQAFPAELVHVVDCQLLQDGSSSSSSNMHDFLVPVFELGLLCSADSPEQRMAMSDVVLTLNKIRKDYVK

HMMPanther: PTHR24420:SF474
1-1092 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MALVRLPVWIFVAALLIASSSTVPCASSLGPIASKSNSSDTDLAALLAFKAQLSDPNNILAGNWTTGTPFCRWVGVSCSSHRRRRQRVTALELPNVPLQGELSSHLGNISFLFILNLTNTGLTGSVPNKIGRLRRLELLDLGHNAMSGGIPAAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTPLLTYLNVGNNSLSGLIPGCIGSLPILQHLNFQANNLTGAVPPAIFNMSKLSTISLISNGLTGPIPGNTSFSLPVLRWFAISKNNFFGQIPLGLAACPYLQVIAMPYNLFEGVLPPWLGRLTNLDAISLGGNNFDAGPIPTELSNLTMLTVLDLTTCNLTGNIPADIGHLGQLSWLHLAMNQLTGPIPASLGNLSSLAILLLKGNLLDGSLPSTVDSMNSLTAVDVTENNLHGDLNFLSTVSNCRKLSTLQMDLNYITGILPDYVGNLSSQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQLRNAIPESIMTIENLQWLDLSGNSLSGFIPSNTALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNKLTSTIPPSLFHLDKIVRLDLSRNFLSGALPVDVGYLKQITIMDLSDNHFSGRIPYSIGQLQMLTHLNLSANGFYDSVPDSFGNLTGLQTLDISHNSISGTIPNYLANFTTLVSLNLSFNKLHGQIPEGGVFANITLQYLEGNSGLCGAARLGFPPCQTTSPNRNNGHMLKYLLPTIIIVVGIVACCLYVVIRKKANHQNTSAGKADLISHQLLSYHELLRATDDFSDDSMLGFGSFGKVFRGRLSNGMVVAIKVIHQHLEHAMRSFDTECRVLRMARHRNLIKILNTCSNLDFRALVLQYMPKGSLEALLHSEQGKQLGFLERLDIMLDVSMAMEYLHHEHYEVVLHCDLKPSNVLFDDDMTAHVADFGIARLLLGDDNSMISASMPGTVGYMAPEYGTLGKASRKSDVFSYGIMLLEVFTAKRPTDAMFVGELNIRQWVQQAFPAELVHVVDCQLLQDGSSSSSSNMHDFLVPVFELGLLCSADSPEQRMAMSDVVLTLNKIRKDYVK

superfamily: SSF52058
36-340 L domain-like,LRR

SNSSDTDLAALLAFKAQLSDPNNILAGNWTTGTPFCRWVGVSCSSHRRRRQRVTALELPNVPLQGELSSHLGNISFLFILNLTNTGLTGSVPNKIGRLRRLELLDLGHNAMSGGIPAAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTPLLTYLNVGNNSLSGLIPGCIGSLPILQHLNFQANNLTGAVPPAIFNMSKLSTISLISNGLTGPIPGNTSFSLPVLRWFAISKNNFFGQIPLGLAACPYLQVIAMPYNLFEGVLPPWLGRLTNLDAISLGGNNF

HMMPfam: PF08263
IPR013210
40-79 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DTDLAALLAFKAQLSDPNNILAGNWTTGTPFCRWVGVSCS

Gene3D: G3DSA:3.80.10.10
41-331 no description

TDLAALLAFKAQLSDPNNILAGNWTTGTPFCRWVGVSCSSHRRRRQRVTALELPNVPLQGELSSHLGNISFLFILNLTNTGLTGSVPNKIGRLRRLELLDLGHNAMSGGIPAAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTPLLTYLNVGNNSLSGLIPGCIGSLPILQHLNFQANNLTGAVPPAIFNMSKLSTISLISNGLTGPIPGNTSFSLPVLRWFAISKNNFFGQIPLGLAACPYLQVIAMPYNLFEGVLPPWLGRLTNLD

Seg: seg
132-141 seg

RLRRLELLDL

Seg: seg
156-170 seg

NLTRLQLLNLQFNQL

HMMSmart: SM00369
IPR003591
157-180 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTRLQLLNLQFNQLYGPIPAELQG

HMMSmart: SM00365
157-183 Leucine-rich repeat, SDS22-like subfamily

LTRLQLLNLQFNQLYGPIPAELQGLHS

ProfileScan: PS51450
IPR001611
159-182 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLQLLNLQFNQLYGPIPAELQGLH

HMMSmart: SM00369
IPR003591
181-205 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LHSLGSMNLRHNYLTGSIPDDLFNN

HMMPfam: PF13855
183-243 LRR_8,Leucine rich repeat

SLGSMNLRHNYLTGSIPDDLFNNTPLLTYLNVGNNSLSGLIPGCIGSLPILQHLNFQANNL

ProfileScan: PS51450
IPR001611
183-205 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLGSMNLRHNYLTGSIPDDLFNN

ProfileScan: PS51450
IPR001611
208-230 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

LLTYLNVGNNSLSGLIPGCIGSL

HMMSmart: SM00369
IPR003591
230-254 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPILQHLNFQANNLTGAVPPAIFNM

Gene3D: G3DSA:3.80.10.10
332-468 no description

AISLGGNNFDAGPIPTELSNLTMLTVLDLTTCNLTGNIPADIGHLGQLSWLHLAMNQLTGPIPASLGNLSSLAILLLKGNLLDGSLPSTVDSMNSLTAVDVTENNLHGDLNFLSTVSNCRKLSTLQMDLNYITGILP

HMMPfam: PF00560
IPR001611
355-376 LRR_1
Leucine-rich repeat

LTVLDLTTCNLTGNIPADIGHL

ProfileScan: PS51450
IPR001611
359-380 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLTTCNLTGNIPADIGHLGQLS

superfamily: SSF52047
368-722 RNI-like,LRR

NIPADIGHLGQLSWLHLAMNQLTGPIPASLGNLSSLAILLLKGNLLDGSLPSTVDSMNSLTAVDVTENNLHGDLNFLSTVSNCRKLSTLQMDLNYITGILPDYVGNLSSQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQLRNAIPESIMTIENLQWLDLSGNSLSGFIPSNTALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNKLTSTIPPSLFHLDKIVRLDLSRNFLSGALPVDVGYLKQITIMDLSDNHFSGRIPYSIGQLQMLTHLNLSANGFYDSVPDSFGNLTGLQTLDISHNSISGTIPNYLANFTTLVSLNLSFNKLHGQIPEGGVFANITLQYL

HMMSmart: SM00369
IPR003591
376-400 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LGQLSWLHLAMNQLTGPIPASLGNL

Seg: seg
396-417 seg

SLGNLSSLAILLLKGNLLDGSL

HMMPfam: PF13855
476-536 LRR_8,Leucine rich repeat

SQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQLRNAIPESIMTIENLQWLDLSGNSL

Gene3D: G3DSA:3.80.10.10
477-730 no description

QLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQLRNAIPESIMTIENLQWLDLSGNSLSGFIPSNTALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNKLTSTIPPSLFHLDKIVRLDLSRNFLSGALPVDVGYLKQITIMDLSDNHFSGRIPYSIGQLQMLTHLNLSANGFYDSVPDSFGNLTGLQTLDISHNSISGTIPNYLANFTTLVSLNLSFNKLHGQIPEGGVFANITLQYLEGNSGLCG

ProfileScan: PS51450
IPR001611
477-500 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLKWFTLSNNKLTGTLPATISNLT

HMMSmart: SM00369
IPR003591
499-520 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTALEVIDLSHNQLRNAIPESI

HMMSmart: SM00365
499-528 Leucine-rich repeat, SDS22-like subfamily

LTALEVIDLSHNQLRNAIPESIMTIENLQW

ProfileScan: PS51450
IPR001611
501-522 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALEVIDLSHNQLRNAIPESIMT

HMMSmart: SM00369
IPR003591
523-547 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

IENLQWLDLSGNSLSGFIPSNTALL

ProfileScan: PS51450
IPR001611
525-547 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQWLDLSGNSLSGFIPSNTALL

ProfileScan: PS51450
IPR001611
549-571 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NIVKLFLESNEISGSIPKDMRNL

HMMSmart: SM00369
IPR003591
571-595 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTNLEHLLLSDNKLTSTIPPSLFHL

HMMSmart: SM00365
571-592 Leucine-rich repeat, SDS22-like subfamily

LTNLEHLLLSDNKLTSTIPPSL

HMMPfam: PF12799
572-609 LRR_4,Leucine Rich repeats (2 copies)

TNLEHLLLSDNKLTSTIPPSLFHLDKIVRLDLSRNFLS

ProfileScan: PS51450
IPR001611
573-595 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEHLLLSDNKLTSTIPPSLFHL

HMMSmart: SM00369
IPR003591
643-666 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LQMLTHLNLSANGFYDSVPDSFGN

ProfileScan: PS51450
IPR001611
645-667 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

MLTHLNLSANGFYDSVPDSFGNL

HMMPfam: PF13855
646-704 LRR_8,Leucine rich repeat

LTHLNLSANGFYDSVPDSFGNLTGLQTLDISHNSISGTIPNYLANFTTLVSLNLSFNKL

HMMSmart: SM00369
IPR003591
667-690 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTGLQTLDISHNSISGTIPNYLAN

HMMSmart: SM00365
667-690 Leucine-rich repeat, SDS22-like subfamily

LTGLQTLDISHNSISGTIPNYLAN

ProfileScan: PS51450
IPR001611
669-691 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLQTLDISHNSISGTIPNYLANF

HMMSmart: SM00369
IPR003591
691-716 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

FTTLVSLNLSFNKLHGQIPEGGVFAN

ProfileScan: PS51450
IPR001611
693-715 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLVSLNLSFNKLHGQIPEGGVFA

Gene3D: G3DSA:3.30.200.20
763-869 no description

VGIVACCLYVVIRKKANHQNTSAGKADLISHQLLSYHELLRATDDFSDDSMLGFGSFGKVFRGRLSNGMVVAIKVIHQHLEHAMRSFDTECRVLRMARHRNLIKILN

superfamily: SSF56112
IPR011009
778-1083 Protein kinase-like (PK-like)
Protein kinase-like domain

ANHQNTSAGKADLISHQLLSYHELLRATDDFSDDSMLGFGSFGKVFRGRLSNGMVVAIKVIHQHLEHAMRSFDTECRVLRMARHRNLIKILNTCSNLDFRALVLQYMPKGSLEALLHSEQGKQLGFLERLDIMLDVSMAMEYLHHEHYEVVLHCDLKPSNVLFDDDMTAHVADFGIARLLLGDDNSMISASMPGTVGYMAPEYGTLGKASRKSDVFSYGIMLLEVFTAKRPTDAMFVGELNIRQWVQQAFPAELVHVVDCQLLQDGSSSSSSNMHDFLVPVFELGLLCSADSPEQRMAMSDVVLTL

HMMSmart: SM00219
IPR020635
808-1083 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSDDSMLGFGSFGKVFRGRLSNGMVVAIKVIHQHLEHAMRSFDTECRVLRMARHRNLIKILNTCSNLDFRALVLQYMPKGSLEALLHSEQGKQLGFLERLDIMLDVSMAMEYLHHEHYEVVLHCDLKPSNVLFDDDMTAHVADFGIARLLLGDDNSMISASMPGTVGYMAPEYGTLGKASRKSDVFSYGIMLLEVFTAKRPTDAMFVGELNIRQWVQQAFPAELVHVVDCQLLQDGSSSSSSNMHDFLVPVFELGLLCSADSPEQRMAMSDVVLTL

HMMSmart: SM00220
IPR002290
808-1055 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSDDSMLGFGSFGKVFRGRLSNGMVVAIKVIHQHLEHAMRSFDTECRVLRMARHRNLIKILNTCSNLDFRALVLQYMPKGSLEALLHSEQGKQLGFLERLDIMLDVSMAMEYLHHEHYEVVLHCDLKPSNVLFDDDMTAHVADFGIARLLLGDDNSMISASMPGTVGYMAPEYGTLGKASRKSDVFSYGIMLLEVFTAKRPTDAMFVGELNIRQWVQQAFPAELVHVVDCQLLQDGSSSSSSNMHDFL

ProfileScan: PS50011
IPR000719
808-1091 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSDDSMLGFGSFGKVFRGRLSNGMVVAIKVIHQHLEHAMRSFDTECRVLRMARHRNLIKILNTCSNLDFRALVLQYMPKGSLEALLHSEQGKQLGFLERLDIMLDVSMAMEYLHHEHYEVVLHCDLKPSNVLFDDDMTAHVADFGIARLLLGDDNSMISASMPGTVGYMAPEYGTLGKASRKSDVFSYGIMLLEVFTAKRPTDAMFVGELNIRQWVQQAFPAELVHVVDCQLLQDGSSSSSSNMHDFLVPVFELGLLCSADSPEQRMAMSDVVLTLNKIRKDYV

HMMPfam: PF07714
IPR001245
812-1012 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

SMLGFGSFGKVFRGRLSNGMVVAIKVIHQHLEHAMRSFDTECRVLRMARHRNLIKILNTCSNLDFRALVLQYMPKGSLEALLHSEQGKQLGFLERLDIMLDVSMAMEYLHHEHYEVVLHCDLKPSNVLFDDDMTAHVADFGIARLLLGDDNSMISASMPGTVGYMAPEYGTLGKASRKSDVFSYGIMLLEVFTAKRPTDAM

PatternScan: PS00107
IPR017441
814-836 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGFGSFGKVFRGRLSNGMVVAIK

Gene3D: G3DSA:1.10.510.10
870-1019 no description

TCSNLDFRALVLQYMPKGSLEALLHSEQGKQLGFLERLDIMLDVSMAMEYLHHEHYEVVLHCDLKPSNVLFDDDMTAHVADFGIARLLLGDDNSMISASMPGTVGYMAPEYGTLGKASRKSDVFSYGIMLLEVFTAKRPTDAMFVGELNI

PatternScan: PS00108
IPR008271
928-940 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VLHCDLKPSNVLF

Seg: seg
1044-1049 seg

SSSSSS


Diseases

Disease Pathogen Avirulence gene
Bacterial Blight

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox