PRGDB00061451 (Xa13)

From PRG Wiki
Revision as of 22:32, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Xa13
Gene Type Reference_R-Genes,_manually_curated
GenBank 89892339 (DQ421396)
Gene Class Other
Domain Type
Chromosome 8
Gene Species Oryza sativa Indica Group

Comment?

Oryza sativa (indica cultivar-group) cultivar IR24 disease resistant allele XA13 (Xa13) gene, complete cds.

DNA Sequence

ATGGCAGGAGGTTTCTTGTCCATGGCTAACCCGGCGGTCACCCTCTCCGGTGTTGCAGGAAACATCATCTCCTTCCTGGTGTTCCTTGCACCAGTGGCGACGTTCTTGCAGGTGTACAAGAAGAAGTCGACGGGAGGGTACAGCTCGGTGCCGTACGTGGTGGCGCTCTTCAGCTCGGTGCTGTGGATCTTCTACGCGCTGGTGAAGACCAACTCGAGGCCGCTGCTGACCATCAACGCCTTCGGCTGCGGCGTCGAGGCCGCCTACATCGTCCTCTACCTCGTCTACGCGCCGCGCCGCGCCAGGCTCCGCACCCTCGCCTTCTTCCTCCTCCTCGACGTCGCCGCCTTCGCCCTCATCGTCGTCACCACCCTCTACCTCGTCCCCAAGCCCCACCAGGTCAAGTTCCTCGGCAGCGTCTGCCTCGCCTTCTCCATGGCCGTCTTCGTCGCCCCTCTCTCCATCATCTTCAAGGTGATCAAGACCAAGAGCGTCGAGTTCATGCCGATCGGGCTCTCCGTCTGCCTCACGCTCAGCGCCGTCGCGTGGTTCTGCTACGGCCTCTTCACCAAGGACCCCTATGTCATGTACCCGAACGTGGGCGGCTTCTTCTTCAGCTGCGTGCAGATGGGGCTCTACTTCTGGTACCGGAAGCCGAGGAACACGGCCGTGCTGCCGACGACGTCCGACTCCATGTCCCCGATCTCCGCCGCCGCCGCCGCCACGCAGAGGGTGATCGAGCTCCCCGCCGGCACGCACGCCTTCACCATCCTGTCCGTGAGCCCCATCCCGATCCTCGGCGTGCACAAGGTCGAGGTGGTGGCCGCCGAGCAGGCGGCCGACGGCGTCGCCGCCGCCGCCGCCGCCGACAAGGAGCTGCTGCAGAACAAGCCGGAGGTGATCGAGATCACCGCCGCCGTGTGA


Protein sequences

Name Description Sequence
disease resistant allele XA13 disease resistant allele XA13 [Oryza sativa Indica Group].

MAGGFLSMANPAVTLSGVAGNIISFLVFLAPVATFLQVYKKKSTGGYSSVPYVVALFSSVLWIFYALVKTNSRPLLTINAFGCGVEAAYIVLYLVYAPRRARLRTLAFFLLLDVAAFALIVVTTLYLVPKPHQVKFLGSVCLAFSMAVFVAPLSIIFKVIKTKSVEFMPIGLSVCLTLSAVAWFCYGLFTKDPYVMYPNVGGFFFSCVQMGLYFWYRKPRNTAVLPTTSDSMSPISAAAAATQRVIELPAGTHAFTILSVSPIPILGVHKVEVVAAEQAADGVAAAAAADKELLQNKPEVIEITAAV


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10791
IPR004316
8-303 RAG1-ACTIVATING PROTEIN 1
RAG1-activating protein-1-related

MANPAVTLSGVAGNIISFLVFLAPVATFLQVYKKKSTGGYSSVPYVVALFSSVLWIFYALVKTNSRPLLTINAFGCGVEAAYIVLYLVYAPRRARLRTLAFFLLLDVAAFALIVVTTLYLVPKPHQVKFLGSVCLAFSMAVFVAPLSIIFKVIKTKSVEFMPIGLSVCLTLSAVAWFCYGLFTKDPYVMYPNVGGFFFSCVQMGLYFWYRKPRNTAVLPTTSDSMSPISAAAAATQRVIELPAGTHAFTILSVSPIPILGVHKVEVVAAEQAADGVAAAAAADKELLQNKPEVIEI

HMMPfam: PF03083
IPR004316
17-100 MtN3_slv
RAG1-activating protein-1-related

GVAGNIISFLVFLAPVATFLQVYKKKSTGGYSSVPYVVALFSSVLWIFYALVKTNSRPLLTINAFGCGVEAAYIVLYLVYAPRR

Seg: seg
99-122 seg

RRARLRTLAFFLLLDVAAFALIVV

HMMPfam: PF03083
IPR004316
136-219 MtN3_slv
RAG1-activating protein-1-related

FLGSVCLAFSMAVFVAPLSIIFKVIKTKSVEFMPIGLSVCLTLSAVAWFCYGLFTKDPYVMYPNVGGFFFSCVQMGLYFWYRKP

Seg: seg
271-290 seg

VEVVAAEQAADGVAAAAAAD


Diseases

Disease Pathogen Avirulence gene
Bacterial Blight Xanthomonas oryzae

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox