PRGDB00061453 (Pikm1-TS)

From PRG Wiki
Revision as of 22:32, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Pikm1-TS
Gene Type Reference_R-Genes,_manually_curated
GenBank 207367329 (AB462324)
Gene Class CNL
Domain Type NBS, LRR, Others
Chromosome 11
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group Pikm1-TS mRNA for NBS-LRR class disease resistance protein, complete cds.

DNA Sequence

ATGGAGGCGGCTGCCATGGCCGTAACCGCAGCCACGGGGGCCTTGGCGCCCGTGCTAGTGAAGCTGGCCGCTTTGCTGGACGACGGGGAGTGCAATCTTCTGGAGGGGAGCCGGAGCGACGCAGAGTTCATCAGATCCGAGCTGGAGGCCGTGCACTCTCTCCTCACCCCAAATATCTTGGGGAGGATGGGGGATGACGATGCGGCGTGCAAGGATGGCTTGATTGCGGAGGTCCGGGAGCTGTCCTACGACCTGGATGATGCCGTCGACGACTTCTTGGAGCTCAATTTCGAGCAGCGAAGAAGCGCAAGCCCTTTCGGTGAGCTCAAGGCAAGAGTTGAGGAGCGTGTCTCCAATCGCTTCTCTGACTGGAAGCTACCGGCGGCGAGCCTTCCGCCGTCGTCGGTACACCGTCGAGCTGGCTTGCCGCCACCAGATGCAGGGCTGGTGGGGATGCACAAACGTAAGGAAGAGCTCATCGAGTTGCTGGAACAAGGGAGCAGTGATGCTTCACGATGGCGCAAGCGAAAACCTCATGTCCCCCTCAGGATAATGGGAGGGGAAATGCAAAAAATCGTGTTCAAGATTCCCATGGTGGACGATAAGAGCCGTACAAAAGCAATGTCATTGGTTGCAAGTACGGTTGGAGTGCACTCGGTTGCAATCGCCGGTGACCTAAGAGACCAGGTTGTGGTGGTCGGTGATGGCATTGACTCCATCAATCTGGTCTCTGCGCTCCGGAAGAAGGTGGGCCCTGCGATGTTTCTGGAGGTCAGCCAAGTAAAGGAAGATGTGAAGGAGATAACGGCGATGCTTGCGCCGGTGAAATCCATATGTGAATTTCACGAGGTCAAAACAATTTGCATCCTTGGATTGCCAGGGGGAGGCAAAACAACGATTGCCCGAGTACTATATCATGCATTGGGAACGCAGTTCCAATGCCGGGTTTTCGCATCAATCTCTCCAAGTTCCAGCCCCAGTCCCAATCTAACAGAGACTCTTGCAGACATTTTCGCTCAAGCACAACTAGGAGTAACTGATACACTTAGCACACCATATGGTGGGAGTGGGACCGGGAGAGCTCTTCAACAACATCTCATCGACAACATATCAGCTTTCCTCCTCAACAAAAAGTATCTCATTGTAATCGATGACATTTGGCATTGGGAAGAATGGGAAGTCATCAGAAAGTCCATTCCCAAGAATGATCTGGGTGGTAGAATAATCATGACTACTCGTCTTAATTCAATAGCTGAGAAGTGCCACACTGATGACAATGATGTTTTTGTCTACGAAGTTGGGGATCTAGATAATAATGATGCTTGGTCGTTGTCTTGGGGGATAGCAACAAAGTCTGGGGCAGGCAACAGGATCGGAACTGGAGAGGATAATTCATGCTATGATATTGTGAACATGTGTTATGGTATGCCTTTAGCACTTATTTGGCTGTCGTCAGCATTGGTTGGAGAGATAGAAGAATTAGGTGGTGCTGAAGTGAAAAAATGTAGGGATTTGAGACACATAGAGGATGGTATTTTGGACATCCCATCCTTACAACCATTGGCGGAGAGTTTATGCCTTGGTTATAACCATCTTCCTCTTTATCTGAGGACTTTGTTGTTGTACTGTAGTGCATACCATTGGTCTAACAGAATCGAAAGGGGTCGTCTGGTCAGGAGGTGGATTGCGGAAGGATTTGTGTCGGAAGAGAAAGAAGCAGAAGGTTACTTTGGCGAGCTTATTAACAGAGGATGGATTACGCAGCACGGAGACAACAACAGTTATAATTACTATGAGATCCACCCCGTGATGCTGGCCTTCCTGAGATGCAAGTCCAAGGAGTACAATTTTTTAACATGCTTGGGTCTGGGATCTGATACTAGTACTAGTGCATCCTCCCCAAGGTTGATTCGCCGGCTGTCTCTTCAGGGGGGGTATCCAGTGGACTGCTTGTCAAGCATGAGTATGGATGTGTCACACACTTGCAGCCTTGTCGTCCTTGGTGACGTGGCGCGACCCAAGGGAATCCCCTTCTATATGTTTAAGCGCTTGCGAGTGTTGGACCTTGAAGATAATAAGGATATACAGGATTCTCATCTGCAGGGCATATGTGAACAGTTAAGCCTCAGAGTGAGGTACCTTGGTCTCAAGGGAACGCGGATCCGAAAGCTCCCTCAGGAGATGAGGAAGCTGAAGCATTTGGAGATTTTGTATGTGGGGAGCACTCGGATCAGTGAACTTCCGCAAGAGATTGGAGAGCTGAAGCATCTGCGGATTCTGGACGTGAGAAACACGGACATCACTGAGCTCCCACTGCAGATACGGGAGCTGCAGCATCTGCACACTCTGGACGTGAGGAACACTCCAATCAGTGAGCTCCCGCCGCAGGTTGGCAAGCTGCAGAATCTCAAGATTATGTGCGTGAGGAGCACTGGGGTTAGGGAGCTCCCAAAGGAGATTGGGGAGCTGAATCATCTACAGACTCTGGACGTGAGAAACACGAGGGTGAGAGAGCTGCCATGGCAAGCTGGCCAGATCTCCCAATCGTTGCGCGTGCTTGCCGGTGACAGTGGCGATGGCGTGCGGTTGCCCGAAGGCGTCTGCGAAGCTCTGATCAACGGTATTCCAGGGGCTACGCGTGCAAAATGCAGGGAGGTTCTGTCCATCGCGATCATCGATCGTTTCGGACCTCCCCTTGTTGGGATATTCAAAGTTCCCGGCAGTCATATGCGTATCCCGAAGATGATCAAAGACCACTTCCGCGTTCTTTCTTGCCTAGACATCAGGCTCTGCCACAAGCTTGAGGATGATGACCAAAAGTTCCTCGCCGAGATGCCCAACCTGCAGACGCTCGTGCTGAGGTTCGAGGCCCTACCAAGACAACCCATAACCATCAACGGCACAGGCTTCCAGATGCTGGAGAGCTTCCGTGTCGACAGCCGGGTGCCAAGGATAGCCTTCCATGAAGACGCCATGCCCAACCTCAAGCTTCTCGAGTTCAAGTTCTACGCCGGCCCAGCAAGCAACGATGCCATCGGCATCACCAACCTGAAGAGCCTCCAAAAGGTGGTCTTTCGGTGCTCGCCATGGTACAAGAGCGACGCCCCTGGCATCAGCGCCACCATTGACGTCGTGAAGAAAGAAGCCGAGGAGCATCCCAACCGGCCGATCACCCTCCTCATCAATGCTGGGTATAAGGAGATATCAACTGAGTCACACGGGAGCAGTGAAAACATTGCGGGCAGCAGTGGGATCGATACTGAGCCTGCACAGGCACAGCATGATAATCTCCCTGCTGTTCGAGATGACTACAAGGGAAAAGGGATTCTTCTTGATGGCAGGTGTCCTACCTGCGGCCGAGCGACTAAAATTGAAGAGGAAACCCAAGATCGAGTAGCAGATATTGAAATTCAAACAGAAACTACTAGCTAG


Protein sequences

Name Description Sequence
NBS-LRR class disease resistance protein NBS-LRR class disease resistance protein [Oryza sativa Japonica Group].

MEAAAMAVTAATGALAPVLVKLAALLDDGECNLLEGSRSDAEFIRSELEAVHSLLTPNILGRMGDDDAACKDGLIAEVRELSYDLDDAVDDFLELNFEQRRSASPFGELKARVEERVSNRFSDWKLPAASLPPSSVHRRAGLPPPDAGLVGMHKRKEELIELLEQGSSDASRWRKRKPHVPLRIMGGEMQKIVFKIPMVDDKSRTKAMSLVASTVGVHSVAIAGDLRDQVVVVGDGIDSINLVSALRKKVGPAMFLEVSQVKEDVKEITAMLAPVKSICEFHEVKTICILGLPGGGKTTIARVLYHALGTQFQCRVFASISPSSSPSPNLTETLADIFAQAQLGVTDTLSTPYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTTRLNSIAEKCHTDDNDVFVYEVGDLDNNDAWSLSWGIATKSGAGNRIGTGEDNSCYDIVNMCYGMPLALIWLSSALVGEIEELGGAEVKKCRDLRHIEDGILDIPSLQPLAESLCLGYNHLPLYLRTLLLYCSAYHWSNRIERGRLVRRWIAEGFVSEEKEAEGYFGELINRGWITQHGDNNSYNYYEIHPVMLAFLRCKSKEYNFLTCLGLGSDTSTSASSPRLIRRLSLQGGYPVDCLSSMSMDVSHTCSLVVLGDVARPKGIPFYMFKRLRVLDLEDNKDIQDSHLQGICEQLSLRVRYLGLKGTRIRKLPQEMRKLKHLEILYVGSTRISELPQEIGELKHLRILDVRNTDITELPLQIRELQHLHTLDVRNTPISELPPQVGKLQNLKIMCVRSTGVRELPKEIGELNHLQTLDVRNTRVRELPWQAGQISQSLRVLAGDSGDGVRLPEGVCEALINGIPGATRAKCREVLSIAIIDRFGPPLVGIFKVPGSHMRIPKMIKDHFRVLSCLDIRLCHKLEDDDQKFLAEMPNLQTLVLRFEALPRQPITINGTGFQMLESFRVDSRVPRIAFHEDAMPNLKLLEFKFYAGPASNDAIGITNLKSLQKVVFRCSPWYKSDAPGISATIDVVKKEAEEHPNRPITLLINAGYKEISTESHGSSENIAGSSGIDTEPAQAQHDNLPAVRDDYKGKGILLDGRCPTCGRATKIEEETQDRVADIEIQTETTS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
11-1072 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ATGALAPVLVKLAALLDDGECNLLEGSRSDAEFIRSELEAVHSLLTPNILGRMGDDDAACKDGLIAEVRELSYDLDDAVDDFLELNFEQRRSASPFGELKARVEERVSNRFSDWKLPAASLPPSSVHRRAGLPPPDAGLVGMHKRKEELIELLEQGSSDASRWRKRKPHVPLRIMGGEMQKIVFKIPMVDDKSRTKAMSLVASTVGVHSVAIAGDLRDQVVVVGDGIDSINLVSALRKKVGPAMFLEVSQVKEDVKEITAMLAPVKSICEFHEVKTICILGLPGGGKTTIARVLYHALGTQFQCRVFASISPSSSPSPNLTETLADIFAQAQLGVTDTLSTPYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTTRLNSIAEKCHTDDNDVFVYEVGDLDNNDAWSLSWGIATKSGAGNRIGTGEDNSCYDIVNMCYGMPLALIWLSSALVGEIEELGGAEVKKCRDLRHIEDGILDIPSLQPLAESLCLGYNHLPLYLRTLLLYCSAYHWSNRIERGRLVRRWIAEGFVSEEKEAEGYFGELINRGWITQHGDNNSYNYYEIHPVMLAFLRCKSKEYNFLTCLGLGSDTSTSASSPRLIRRLSLQGGYPVDCLSSMSMDVSHTCSLVVLGDVARPKGIPFYMFKRLRVLDLEDNKDIQDSHLQGICEQLSLRVRYLGLKGTRIRKLPQEMRKLKHLEILYVGSTRISELPQEIGELKHLRILDVRNTDITELPLQIRELQHLHTLDVRNTPISELPPQVGKLQNLKIMCVRSTGVRELPKEIGELNHLQTLDVRNTRVRELPWQAGQISQSLRVLAGDSGDGVRLPEGVCEALINGIPGATRAKCREVLSIAIIDRFGPPLVGIFKVPGSHMRIPKMIKDHFRVLSCLDIRLCHKLEDDDQKFLAEMPNLQTLVLRFEALPRQPITINGTGFQMLESFRVDSRVPRIAFHEDAMPNLKLLEFKFYAGPASNDAIGITNLKSLQKVVFRCSPWYKSDAPGISATIDVVKKEAEEHPNRPITLLINAGYKEISTES

HMMPanther: PTHR23155:SF192
11-1072 PTHR23155:SF192,OS10G0132500 PROTEIN

ATGALAPVLVKLAALLDDGECNLLEGSRSDAEFIRSELEAVHSLLTPNILGRMGDDDAACKDGLIAEVRELSYDLDDAVDDFLELNFEQRRSASPFGELKARVEERVSNRFSDWKLPAASLPPSSVHRRAGLPPPDAGLVGMHKRKEELIELLEQGSSDASRWRKRKPHVPLRIMGGEMQKIVFKIPMVDDKSRTKAMSLVASTVGVHSVAIAGDLRDQVVVVGDGIDSINLVSALRKKVGPAMFLEVSQVKEDVKEITAMLAPVKSICEFHEVKTICILGLPGGGKTTIARVLYHALGTQFQCRVFASISPSSSPSPNLTETLADIFAQAQLGVTDTLSTPYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTTRLNSIAEKCHTDDNDVFVYEVGDLDNNDAWSLSWGIATKSGAGNRIGTGEDNSCYDIVNMCYGMPLALIWLSSALVGEIEELGGAEVKKCRDLRHIEDGILDIPSLQPLAESLCLGYNHLPLYLRTLLLYCSAYHWSNRIERGRLVRRWIAEGFVSEEKEAEGYFGELINRGWITQHGDNNSYNYYEIHPVMLAFLRCKSKEYNFLTCLGLGSDTSTSASSPRLIRRLSLQGGYPVDCLSSMSMDVSHTCSLVVLGDVARPKGIPFYMFKRLRVLDLEDNKDIQDSHLQGICEQLSLRVRYLGLKGTRIRKLPQEMRKLKHLEILYVGSTRISELPQEIGELKHLRILDVRNTDITELPLQIRELQHLHTLDVRNTPISELPPQVGKLQNLKIMCVRSTGVRELPKEIGELNHLQTLDVRNTRVRELPWQAGQISQSLRVLAGDSGDGVRLPEGVCEALINGIPGATRAKCREVLSIAIIDRFGPPLVGIFKVPGSHMRIPKMIKDHFRVLSCLDIRLCHKLEDDDQKFLAEMPNLQTLVLRFEALPRQPITINGTGFQMLESFRVDSRVPRIAFHEDAMPNLKLLEFKFYAGPASNDAIGITNLKSLQKVVFRCSPWYKSDAPGISATIDVVKKEAEEHPNRPITLLINAGYKEISTES

Gene3D: G3DSA:3.40.50.300
262-412 G3DSA:3.40.50.300

KEDVKEITAMLAPVKSICEFHEVKTICILGLPGGGKTTIARVLYHALGTQFQCRVFASISPSSSPSPNLTETLADIFAQAQLGVTDTLSTPYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTT

HMMPfam: PF00931
IPR002182
279-571 NB-ARC,NBS
NB-ARC

CEFHEVKTICILGLPGGGKTTIARVLYHALGTQFQCRVFASISPSSSPSPNLTETLADIFAQAQLGVTDTLSTPYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTTRLNSIAEKCHTDDNDVFVYEVGDLDNNDAWSLSWGIATKSGAGNRIGTGEDNSCYDIVNMCYGMPLALIWLSSALVGEIEELGGAEVKKCRDLRHIEDGILDIPSLQPLAESLCLGYNHLPLYLRTLLLYCSAYHWSNRIERGRLVRRWIAEGFVSEEK

superfamily: SSF52540
282-512 SSF52540

HEVKTICILGLPGGGKTTIARVLYHALGTQFQCRVFASISPSSSPSPNLTETLADIFAQAQLGVTDTLSTPYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTTRLNSIAEKCHTDDNDVFVYEVGDLDNNDAWSLSWGIATKSGAGNRIGTGEDNSCYDIVNMCYGMPLALIWLSSALVGEIEELGGAEVKKCRDLRHIEDGI

HMMSmart: SM00382
IPR003593
283-429 AAA,NBS
AAA+ ATPase domain

EVKTICILGLPGGGKTTIARVLYHALGTQFQCRVFASISPSSSPSPNLTETLADIFAQAQLGVTDTLSTPYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTTRLNSIAEKCHTDDNDVF

FPrintScan: PR00364
IPR000767
286-301 DISEASERSIST
Disease resistance protein

TICILGLPGGGKTTIA

FPrintScan: PR00364
IPR000767
373-387 DISEASERSIST
Disease resistance protein

FLLNKKYLIVIDDIW

FPrintScan: PR00364
IPR000767
473-487 DISEASERSIST
Disease resistance protein

CYGMPLALIWLSSAL

Gene3D: G3DSA:3.80.10.10
514-536 G3DSA:3.80.10.10

DIPSLQPLAESLCLGYNHLPLYL

superfamily: SSF52047
639-1032 SSF52047,LRR

RLSLQGGYPVDCLSSMSMDVSHTCSLVVLGDVARPKGIPFYMFKRLRVLDLEDNKDIQDSHLQGICEQLSLRVRYLGLKGTRIRKLPQEMRKLKHLEILYVGSTRISELPQEIGELKHLRILDVRNTDITELPLQIRELQHLHTLDVRNTPISELPPQVGKLQNLKIMCVRSTGVRELPKEIGELNHLQTLDVRNTRVRELPWQAGQISQSLRVLAGDSGDGVRLPEGVCEALINGIPGATRAKCREVLSIAIIDRFGPPLVGIFKVPGSHMRIPKMIKDHFRVLSCLDIRLCHKLEDDDQKFLAEMPNLQTLVLRFEALPRQPITINGTGFQMLESFRVDSRVPRIAFHEDAMPNLKLLEFKFYAGPASNDAIGITNLKSLQKVVFRCSPWYK

Gene3D: G3DSA:3.80.10.10
677-873 G3DSA:3.80.10.10

PFYMFKRLRVLDLEDNKDIQDSHLQGICEQLSLRVRYLGLKGTRIRKLPQEMRKLKHLEILYVGSTRISELPQEIGELKHLRILDVRNTDITELPLQIRELQHLHTLDVRNTPISELPPQVGKLQNLKIMCVRSTGVRELPKEIGELNHLQTLDVRNTRVRELPWQAGQISQSLRVLAGDSGDGVRLPEGVCEALIN

FPrintScan: PR00364
IPR000767
679-695 DISEASERSIST
Disease resistance protein

YMFKRLRVLDLEDNKDI

HMMPfam: PF12799
756-795 LRR_4,Leucine Rich repeats (2 copies)

HLRILDVRNTDITELPLQIRELQHLHTLDVRNTPISELPP

Gene3D: G3DSA:3.80.10.10
926-981 G3DSA:3.80.10.10

LDIRLCHKLEDDDQKFLAEMPNLQTLVLRFEALPRQPITINGTGFQMLESFRVDSR


Diseases

Disease Pathogen Avirulence gene
Rice blast disease Magnaporthe grisea

List of References

Ikuo Ashikawa, Nagao Hayashi, Hiroko Yamane, Hiroyuki Kanamori, Jianzhong Wu, Takashi Matsumoto, Kazuko Ono, Masahiro Yano
Two adjacent nucleotide-binding site-leucine-rich repeat class genes are required to confer Pikm-specific rice blast resistance.
Genetics: 2008, 180(4);2267-76
PubMed:18940787 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox