PRGDB00061459 (Pi5-2)

From PRG Wiki
Revision as of 22:32, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Pi5-2
Gene Type Reference_R-Genes,_manually_curated
GenBank 213958602 (EU869186)
Gene Class CNL
Domain Type NBS, LRR, Others
Chromosome 9
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group Pi5-2 (Pi5-2) gene, complete cds.

DNA Sequence

ATGGCCACAGCCGGCGCTGCCGTTGACCGGCTTCTACGCCGTCTGGCCTCCGGTGCTGGCCGTCTGGAGCTGCCCTCGAGCATAGACGAGGACATGGCGCATGTAAAGCGAACCCTGGCGAGGTTGCAAGATGTGCTGCTAACCGTAGAAGGGAAATACTTCAAGATGGGCGCGGAGGTGCAGGAATGGATGAGGAAGATCAAGCAGATTGCTTACGGCATTCAAGATTTGCTGGATGAGTTTGAGGACAGTAGCGGCACCGGATCCCAAAGGAACGGCTCCAGGATTTCAGAGGGAACGCTATCGTGTTCGTCAGCTCCATTTTTCTGCCATCTTAGTAGATCACAAAGAATAAGGGTACTGAAAAGAAAGTTAGATCAATCAACAAAAGATACTTCTGTATTTAGTTTACTGCAGCACAGCTTATCCAATCTTGACAAATCCAATGAGCAAGAAGTTCTGTTACATAGAACTGAAATCATTGGAAGGGATACTGACAAAGAAAATATAAAAAATCTATTGTTACAAAATGATGTGGATAAATTACCCATCATTCCGATAGTTGGCCTTGCGGGGCTGGGAAAAACGGCTGTAGCAAAATTGATTTTCCATGAACAGGGAGAAGGGTGGAATTTTGATCAGCGCATATGGGTCCATTTGGACAAGAAATTGGATCTTAACAAAATTGCTAACAGTATTATCTCACAAGTTAACCAATCAGTAGATACCACAAAGAATCAAATTCAGAACAACTTACAGTTTAAAAGGAATTGTCTTCAAGAAGTTCTTTGTGACCAAAGCAGTTTGATAGTATTGGATGACTTATTTAGCACAGAGGAAAACCAGATTGCAGAGTTGAAGGAAATGTTGAGGGGTACAAAGAAGGGAACCAAGATCATTGTGACTACTTCCAGTGAAATATCTGCAGAGCTAATACACACAGTTCCACCATACAAGTTGGGCCCTTTATCTGAAGGTGACTGTTCAACAATATTTTGTCAAAGAGCATTTGGTGATGGACATGAAAACAGCAGCCTCACTGAAATTGCGAAGCAAATTGTGAAAAGGTGTGAAGGCATACCGGCTGTAGCTTATTCTCTTGGTTCATTGGTTCGTAACAAGAATAAGGAGGCCTGGTTATATGCAAGAGACAAAGAAATATGGGAATTACCAACATTATTTCCTAATGGGTTTGAATTACTTGCATCGTTCAGTGAAATGTATATATGTATGCCCTCGGCTTTAAAATCATGCTTTGCATACTTATCAACCATACCCAAAGGAACAATAATTGATAGGGAGAAACTTATTGAACAGTGGATAGCACTTGACATGGTTGGGTCGAAGCATGGGACCTTACCTGCTTATGTGCAAGGAGAGATGTTCATCCAGCAACTTCTATCGATATCTTTTCTTCAAGTCCGAAACAAGCCCTCTGCCACCAGAATCAGAGACACCAATCAATCTAAGGAACTCCGTATCCATAACTTGGTCCATGACTTTGCAATGTATGTTGCCCGTGATGATCTCATAATTCTGGATGGTGGAGAGAAGGCCAGTAGCCTTAGAAAAAACATCCATGTCTTCTATGGAGTTGTGAACAATGATATTGGACAATCAGCACTCCGGAAAGGTCTGCTCAGCAGTGCAAGGGCAGTACACTTCAAGAACTGTAAGTCAGAAAAGCTTCTTGTAGAGGCATTCTCAGTACTGAATCATTTGCGTGTCTTGGATCTTAGTGGTTGTTGTATTGTAGAATTACCGGATTTCATTACCAATTTGAGGCATCTGAGATACCTGGATGTTTCATATTCAAGGATTCTGTCATTGTCAACCCAGCTAACTAGTTTGAGTAATCTGGAGGTATTGGATCTTTCAGAAACTTCTCTTGAGTTGTTACCATCTTCAATTGGCTCATTTGAAAAATTAAAATACTTGAATCTACAAGGATGTGATAAACTTGTAAACTTGCCCCCATTTGTCTGTGATCTCAAGAGGCTAGAGAATCTCAACCTATCATACTGTTATGGAATCACTATGCTACCCCCAAATCTATGGAAACTTCATGAACTTCGAATTTTGGACCTCTCTAGTTGCACAGATCTTCAAGAAATGCCATATTTATTTGGTAACTTAGCAAGCTTAGAAAATCTAAACATGTCGAAATGCTCCAAGCTTGAACAACTACCAGAATCTCTTGGTGATCTTTGTTACCTACGATCCTTTAACCTATCAGGTTGTTCTGGGCTTAAGATGCTGCCAGAATCTCTGAAAAATCTTACAAATTTAGAGTATATTAATTTGTCAAATATTGGGGAGAGTATCGATTTCAATCAGATACAACAACTACGGCACATTCTCAAGAAAACATTTTTTTCTGGAGATATTGGAGGGAGTGAACTCCAAACATGTGAACACGCTGCTGATTCTGCAGACAGTAAGAAGGAAATTACAATGGATTTTTCTGCAAATTTGCATGGAAATATTACTTTGCCACCCAAGTGCTCAACTGAAGAGAAATCTGGTGAAAACTCTGAACGATTCCTATCAGCTGCAGTTAGGGAGGATTCAAGCAGCACTGATGTTTCTACATATGTCAAGCCGGTGGTGTCCTCACTTATTGGAGTGCTGCGCAGACCGACTAGGTTGGATGTGCCAGCTGGCGCGATGGCTTCTCAGGTTGGCCTGGCCCAGATGCCATCTAGCAACAATGGTAAGGCTGGACCGCATCCAACAATGGCTGCAGCTCAGACCCCGGAGATTGATCAACCTGTGCATAAAAGGGTCCGGTGGGATGATATAATAGACTACTCCCGTCCTCCCAACTCAAAACCTGCCAGGAGTGCATCTCTTGTGCAGTCGACCGATCTGTCGACACCAAAGAAAAGTTATAAAAAAATTCACTCAATGCCGGTGGTCTATTCGTCAATTCCAAAAGGGAGTTCCGGAGGAACATACTTGATGCCAGCAAAGGCTATCGCTTCTTCCTACAGGAGGTATAGCCCACAGAGATGGGAACAGCACATTGGTTATCAAGGAACGGATGAAGATGAACTGATGGTCGTGCCACCATTTGGTGAGTGGGATCAGTCCCCCACATTACGAAAATCTGACTTTCGGTATGAGAAGGTCTTCGCTAAACTCACCGAAGAGAAGATGTCTGGTCAAAGGCAGAAACCGCAACAGGTATGA


Protein sequences

Name Description Sequence
Pi5-2 Pi5-2 [Oryza sativa Japonica Group].

MATAGAAVDRLLRRLASGAGRLELPSSIDEDMAHVKRTLARLQDVLLTVEGKYFKMGAEVQEWMRKIKQIAYGIQDLLDEFEDSSGTGSQRNGSRISEGTLSCSSAPFFCHLSRSQRIRVLKRKLDQSTKDTSVFSLLQHSLSNLDKSNEQEVLLHRTEIIGRDTDKENIKNLLLQNDVDKLPIIPIVGLAGLGKTAVAKLIFHEQGEGWNFDQRIWVHLDKKLDLNKIANSIISQVNQSVDTTKNQIQNNLQFKRNCLQEVLCDQSSLIVLDDLFSTEENQIAELKEMLRGTKKGTKIIVTTSSEISAELIHTVPPYKLGPLSEGDCSTIFCQRAFGDGHENSSLTEIAKQIVKRCEGIPAVAYSLGSLVRNKNKEAWLYARDKEIWELPTLFPNGFELLASFSEMYICMPSALKSCFAYLSTIPKGTIIDREKLIEQWIALDMVGSKHGTLPAYVQGEMFIQQLLSISFLQVRNKPSATRIRDTNQSKELRIHNLVHDFAMYVARDDLIILDGGEKASSLRKNIHVFYGVVNNDIGQSALRKGLLSSARAVHFKNCKSEKLLVEAFSVLNHLRVLDLSGCCIVELPDFITNLRHLRYLDVSYSRILSLSTQLTSLSNLEVLDLSETSLELLPSSIGSFEKLKYLNLQGCDKLVNLPPFVCDLKRLENLNLSYCYGITMLPPNLWKLHELRILDLSSCTDLQEMPYLFGNLASLENLNMSKCSKLEQLPESLGDLCYLRSFNLSGCSGLKMLPESLKNLTNLEYINLSNIGESIDFNQIQQLRHILKKTFFSGDIGGSELQTCEHAADSADSKKEITMDFSANLHGNITLPPKCSTEEKSGENSERFLSAAVREDSSSTDVSTYVKPVVSSLIGVLRRPTRLDVPAGAMASQVGLAQMPSSNNGKAGPHPTMAAAQTPEIDQPVHKRVRWDDIIDYSRPPNSKPARSASLVQSTDLSTPKKSYKKIHSMPVVYSSIPKGSSGGTYLMPAKAIASSYRRYSPQRWEQHIGYQGTDEDELMVVPPFGEWDQSPTLRKSDFRYEKVFAKLTEEKMSGQRQKPQQV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
36-783 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KRTLARLQDVLLTVEGKYFKMGAEVQEWMRKIKQIAYGIQDLLDEFEDSSGTGSQRNGSRISEGTLSCSSAPFFCHLSRSQRIRVLKRKLDQSTKDTSVFSLLQHSLSNLDKSNEQEVLLHRTEIIGRDTDKENIKNLLLQNDVDKLPIIPIVGLAGLGKTAVAKLIFHEQGEGWNFDQRIWVHLDKKLDLNKIANSIISQVNQSVDTTKNQIQNNLQFKRNCLQEVLCDQSSLIVLDDLFSTEENQIAELKEMLRGTKKGTKIIVTTSSEISAELIHTVPPYKLGPLSEGDCSTIFCQRAFGDGHENSSLTEIAKQIVKRCEGIPAVAYSLGSLVRNKNKEAWLYARDKEIWELPTLFPNGFELLASFSEMYICMPSALKSCFAYLSTIPKGTIIDREKLIEQWIALDMVGSKHGTLPAYVQGEMFIQQLLSISFLQVRNKPSATRIRDTNQSKELRIHNLVHDFAMYVARDDLIILDGGEKASSLRKNIHVFYGVVNNDIGQSALRKGLLSSARAVHFKNCKSEKLLVEAFSVLNHLRVLDLSGCCIVELPDFITNLRHLRYLDVSYSRILSLSTQLTSLSNLEVLDLSETSLELLPSSIGSFEKLKYLNLQGCDKLVNLPPFVCDLKRLENLNLSYCYGITMLPPNLWKLHELRILDLSSCTDLQEMPYLFGNLASLENLNMSKCSKLEQLPESLGDLCYLRSFNLSGCSGLKMLPESLKNLTNLEYINLSNIGESIDFNQIQQL

superfamily: SSF52540
142-392 SSF52540

LSNLDKSNEQEVLLHRTEIIGRDTDKENIKNLLLQNDVDKLPIIPIVGLAGLGKTAVAKLIFHEQGEGWNFDQRIWVHLDKKLDLNKIANSIISQVNQSVDTTKNQIQNNLQFKRNCLQEVLCDQSSLIVLDDLFSTEENQIAELKEMLRGTKKGTKIIVTTSSEISAELIHTVPPYKLGPLSEGDCSTIFCQRAFGDGHENSSLTEIAKQIVKRCEGIPAVAYSLGSLVRNKNKEAWLYARDKEIWELPT

Gene3D: G3DSA:3.40.50.300
161-305 G3DSA:3.40.50.300

IGRDTDKENIKNLLLQNDVDKLPIIPIVGLAGLGKTAVAKLIFHEQGEGWNFDQRIWVHLDKKLDLNKIANSIISQVNQSVDTTKNQIQNNLQFKRNCLQEVLCDQSSLIVLDDLFSTEENQIAELKEMLRGTKKGTKIIVTTSS

HMMPfam: PF00931
IPR002182
164-449 NB-ARC,NBS
NB-ARC

DTDKENIKNLLLQNDVDKLPIIPIVGLAGLGKTAVAKLIFHEQGEGWNFDQRIWVHLDKKLDLNKIANSIISQVNQSVDTTKNQIQNNLQFKRNCLQEVLCDQSSLIVLDDLFSTEENQIAELKEMLRGTKKGTKIIVTTSSEISAELIHTVPPYKLGPLSEGDCSTIFCQRAFGDGHENSSLTEIAKQIVKRCEGIPAVAYSLGSLVRNKNKEAWLYARDKEIWELPTLFPNGFELLASFSEMYICMPSALKSCFAYLSTIPKGTIIDREKLIEQWIALDMVGSK

FPrintScan: PR00364
IPR000767
184-199 DISEASERSIST
Disease resistance protein

IIPIVGLAGLGKTAVA

FPrintScan: PR00364
IPR000767
262-276 DISEASERSIST
Disease resistance protein

VLCDQSSLIVLDDLF

FPrintScan: PR00364
IPR000767
357-371 DISEASERSIST
Disease resistance protein

CEGIPAVAYSLGSLV

Gene3D: G3DSA:3.80.10.10
543-785 G3DSA:3.80.10.10

RKGLLSSARAVHFKNCKSEKLLVEAFSVLNHLRVLDLSGCCIVELPDFITNLRHLRYLDVSYSRILSLSTQLTSLSNLEVLDLSETSLELLPSSIGSFEKLKYLNLQGCDKLVNLPPFVCDLKRLENLNLSYCYGITMLPPNLWKLHELRILDLSSCTDLQEMPYLFGNLASLENLNMSKCSKLEQLPESLGDLCYLRSFNLSGCSGLKMLPESLKNLTNLEYINLSNIGESIDFNQIQQLRH

superfamily: SSF52047
547-789 SSF52047,LRR

LSSARAVHFKNCKSEKLLVEAFSVLNHLRVLDLSGCCIVELPDFITNLRHLRYLDVSYSRILSLSTQLTSLSNLEVLDLSETSLELLPSSIGSFEKLKYLNLQGCDKLVNLPPFVCDLKRLENLNLSYCYGITMLPPNLWKLHELRILDLSSCTDLQEMPYLFGNLASLENLNMSKCSKLEQLPESLGDLCYLRSFNLSGCSGLKMLPESLKNLTNLEYINLSNIGESIDFNQIQQLRHILKK

HMMPfam: PF13855
553-607 LRR_8,Leucine rich repeat

VHFKNCKSEKLLVEAFSVLNHLRVLDLSGCCIVELPDFITNLRHLRYLDVSYSRI

ProfileScan: PS51450
IPR001611
573-594 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLRVLDLSGCCIVELPDFITNL

ProfileScan: PS51450
IPR001611
596-618 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLRYLDVSYSRILSLSTQLTSLS

ProfileScan: PS51450
IPR001611
619-640 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEVLDLSETSLELLPSSIGSF

HMMPfam: PF12799
619-660 LRR_4,Leucine Rich repeats (2 copies)

NLEVLDLSETSLELLPSSIGSFEKLKYLNLQGCDKLVNLPPF

ProfileScan: PS51450
IPR001611
642-664 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLKYLNLQGCDKLVNLPPFVCDL

ProfileScan: PS51450
IPR001611
666-689 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLENLNLSYCYGITMLPPNLWKLH

HMMPfam: PF00560
IPR001611
666-688 LRR_1
Leucine-rich repeat

RLENLNLSYCYGITMLPPNLWKL

FPrintScan: PR00364
IPR000767
686-702 DISEASERSIST
Disease resistance protein

WKLHELRILDLSSCTDL

ProfileScan: PS51450
IPR001611
690-712 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELRILDLSSCTDLQEMPYLFGNL

HMMPfam: PF00560
IPR001611
739-760 LRR_1
Leucine-rich repeat

LRSFNLSGCSGLKMLPESLKNL


Diseases

Disease Pathogen Avirulence gene
Rice blast disease Magnaporthe grisea

List of References

Sang-Kyu Lee, Min-Young Song, Young-Su Seo, Hye-Kyung Kim, Seho Ko, Pei-Jian Cao, Jung-Pil Suh, Gihwan Yi, Jae-Hwan Roh, Sichul Lee, Gynheung An, Tae-Ryong Hahn, Guo-Liang Wang, Pamela Ronald, Jong-Seong Jeon
Rice Pi5-mediated resistance to Magnaporthe oryzae requires the presence of two coiled-coil-nucleotide-binding-leucine-rich repeat genes.
Genetics: 2009, 181(4);1627-38
PubMed:19153255 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox