PRGDB00061461 (Serk3A)

From PRG Wiki
Revision as of 22:32, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Serk3A
Gene Type Reference_R-Genes,_manually_curated
GenBank 309754758 (HQ332144)
Gene Class RLK
Domain Type LRR, Ser-Thr Kinase
Gene Species Nicotiana benthamiana

Comment?

Nicotiana benthamiana SERK3A (Serk3A) mRNA, complete cds.

DNA Sequence

ATGGATCAGTCGGTCTTGGTGATCTGGGTCTTTCTATGCTTAATTCGGCTGCTTTTGAACTTGTCACCGGTTGCCGGTAACGCTGAAGGTGATGCTTTGTATGCTCAGAAGACCAATTTGGGTGATCCTAATAGTGTCCTACAGAGTTGGGATCCAACACTTGTTAATCCTTGTACTTGGTTCCATGTGACATGCAACAGTGAAAATAGTGTTACTAGAGTTGATCTTGGAAATGCAAATCTAACAGGTCAACTGGTACCACAGCTTGGCCAACTCCAGAAATTGCAGTACTTGGAGCTTTATAGTAATAACATAAGCGGAAGAATTCCAAATGAACTGGGAAACTTGACAGAGTTGGTTAGCTTGGATCTTTACCTGAACAACTTAAATGGTCCAATCCCTGACACACTGGGCAAGCTTCAGAAACTACGCTTCCTGAGGCTGAATAATAACAGTTTGAGTGGACGTATTCCCATGTCTCTAACCACCATTCTTGTACTTCAAGTACTTGATCTCTCAAGCAATCATTTGACAGGACCAGTTCCAGTCAATGGTTCCTTTTCGCTTTTTACTCCTATAAGTTTTGCTAATAACCAATTGGAAGTTCCTCCAGCTTCTCCGCCTCCGCCTCTTCCTCCTACACCCTCATCTTCTTCTTCAGTGGGCAACAGTGCAACTGGAGCCATCGCTGGAGGAGTTGCTGCAGGCGCTGCTCTTCTATTTGCAGCTCCTGCAATTTTTCTTGCTTGGTGGCGTCGGAGGAAACCACAAGATCACTTCTTTGATGTTCCTGCTGAGGAGGATCCAGAAGTTCATCTAGGACAACTCAAGAGGTTTTCCTTGCGTGAACTACAAGTTGCATCAGATAATTTTAGCAACAAAAATATACTTGGTAGAGGTGGATTTGGTAAGGTTTATAAGGGCCGGTTAGCTGATGGCTCTTTAGTTGCAGTGAAAAGACTGAAAGAGGAACGTACTCAAGGTGGGGAGTTACAGTTTCAGACAGAAGTAGAAATGATCAGCATGGCTGTACACCGAAATCTACTTCGTTTAAGGGGCTTTTGCATGACTCTCACTGAGCGCGTGCTTGTTTATCCATACATGGAGAACGGAAGTGTTGCATCACGTTTAAGAGAGCGGCCAGAATCGGAGCCCCCACTTGACTGGCCAAAAAGGAAGCATATTGCACTTGGGTCGGCAAGAGGCCTTGCTTACTTGCATGATCATTGTGATCCTAAGATTATTCATCGTGATGTCAAAGCCGCAAATATCTTATTGGATGAGGAGTTTGAAGCAGTTGTTGGGGATTTTGGGTTAGCTAAACTCATGGACTACAAGGATACTCACGTTACCACTGCTGTACGTGGTACAATTGGGCATATTGCCCCTGAATATTTATCCACTGGTAAATCTTCTGAGAAGACGGATGTGTTTGGCTATGGGGTTATGCTGCTAGAGCTCATAACTGGCCAAAGGGCTTTTGATCTTGCTCGACTTGCAAATGATGATGATGTCATGTTACTTGATTGGGTGAAGGGACTCCTGAACGACAAGAAATATGAAACATTAGTTGATGCCGATCTCCAAGGTAATTACAATGAAGAAGAGGTGGAGCAGCTTATTCAGGTAGCTCTACTCTGCACGCAGAGTACGCCTACAGAACGTCCAAAGATGTCAGAAGTTGTTAGAATGCTTGAAGGCGACGGCCTTGCTGAGAGGTGGGAGGAATGGCAAAAGGAGGAGATGTTCAGGCAAGATTACAACCATGTCCACCAGCCCCATACTGATTGGATAATAGCCGACTCCACTTCAAATATCCGACCAGATGAATTGTCGGGGCCAAGATGA


Protein sequences

Name Description Sequence
SERK3A SERK3A [Nicotiana benthamiana].

MDQSVLVIWVFLCLIRLLLNLSPVAGNAEGDALYAQKTNLGDPNSVLQSWDPTLVNPCTWFHVTCNSENSVTRVDLGNANLTGQLVPQLGQLQKLQYLELYSNNISGRIPNELGNLTELVSLDLYLNNLNGPIPDTLGKLQKLRFLRLNNNSLSGRIPMSLTTILVLQVLDLSSNHLTGPVPVNGSFSLFTPISFANNQLEVPPASPPPPLPPTPSSSSSVGNSATGAIAGGVAAGAALLFAAPAIFLAWWRRRKPQDHFFDVPAEEDPEVHLGQLKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGSLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTLTERVLVYPYMENGSVASRLRERPESEPPLDWPKRKHIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLNDKKYETLVDADLQGNYNEEEVEQLIQVALLCTQSTPTERPKMSEVVRMLEGDGLAERWEEWQKEEMFRQDYNHVHQPHTDWIIADSTSNIRPDELSGPR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF351
3-607 PTHR24420:SF351,SUBFAMILY NOT NAMED

QSVLVIWVFLCLIRLLLNLSPVAGNAEGDALYAQKTNLGDPNSVLQSWDPTLVNPCTWFHVTCNSENSVTRVDLGNANLTGQLVPQLGQLQKLQYLELYSNNISGRIPNELGNLTELVSLDLYLNNLNGPIPDTLGKLQKLRFLRLNNNSLSGRIPMSLTTILVLQVLDLSSNHLTGPVPVNGSFSLFTPISFANNQLEVPPASPPPPLPPTPSSSSSVGNSATGAIAGGVAAGAALLFAAPAIFLAWWRRRKPQDHFFDVPAEEDPEVHLGQLKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGSLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTLTERVLVYPYMENGSVASRLRERPESEPPLDWPKRKHIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLNDKKYETLVDADLQGNYNEEEVEQLIQVALLCTQSTPTERPKMSEVVRMLEGDGLAERWEEWQKEEMFRQDYNHVHQPHTDWIIADSTSNIR

HMMPanther: PTHR24420
3-607 PTHR24420,FAMILY NOT NAMED

QSVLVIWVFLCLIRLLLNLSPVAGNAEGDALYAQKTNLGDPNSVLQSWDPTLVNPCTWFHVTCNSENSVTRVDLGNANLTGQLVPQLGQLQKLQYLELYSNNISGRIPNELGNLTELVSLDLYLNNLNGPIPDTLGKLQKLRFLRLNNNSLSGRIPMSLTTILVLQVLDLSSNHLTGPVPVNGSFSLFTPISFANNQLEVPPASPPPPLPPTPSSSSSVGNSATGAIAGGVAAGAALLFAAPAIFLAWWRRRKPQDHFFDVPAEEDPEVHLGQLKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGSLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTLTERVLVYPYMENGSVASRLRERPESEPPLDWPKRKHIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLNDKKYETLVDADLQGNYNEEEVEQLIQVALLCTQSTPTERPKMSEVVRMLEGDGLAERWEEWQKEEMFRQDYNHVHQPHTDWIIADSTSNIR

superfamily: SSF52058
23-203 SSF52058,LRR

PVAGNAEGDALYAQKTNLGDPNSVLQSWDPTLVNPCTWFHVTCNSENSVTRVDLGNANLTGQLVPQLGQLQKLQYLELYSNNISGRIPNELGNLTELVSLDLYLNNLNGPIPDTLGKLQKLRFLRLNNNSLSGRIPMSLTTILVLQVLDLSSNHLTGPVPVNGSFSLFTPISFANNQLEVP

HMMPfam: PF08263
IPR013210
27-66 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NAEGDALYAQKTNLGDPNSVLQSWDPTLVNPCTWFHVTCN

Gene3D: G3DSA:3.80.10.10
28-199 G3DSA:3.80.10.10

AEGDALYAQKTNLGDPNSVLQSWDPTLVNPCTWFHVTCNSENSVTRVDLGNANLTGQLVPQLGQLQKLQYLELYSNNISGRIPNELGNLTELVSLDLYLNNLNGPIPDTLGKLQKLRFLRLNNNSLSGRIPMSLTTILVLQVLDLSSNHLTGPVPVNGSFSLFTPISFANNQ

HMMPfam: PF00560
IPR001611
94-116 LRR_1
Leucine-rich repeat

KLQYLELYSNNISGRIPNELGNL

HMMPfam: PF00560
IPR001611
167-184 LRR_1
Leucine-rich repeat

LQVLDLSSNHLTGPVPVN

Gene3D: G3DSA:2.60.120.200
IPR013320
200-314 ConA_like_subgrp
Concanavalin A-like lectin/glucanase, subgroup

LEVPPASPPPPLPPTPSSSSSVGNSATGAIAGGVAAGAALLFAAPAIFLAWWRRRKPQDHFFDVPAEEDPEVHLGQLKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGS

superfamily: SSF56112
IPR011009
261-573 Kinase_like
Protein kinase-like domain

FDVPAEEDPEVHLGQLKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGSLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTLTERVLVYPYMENGSVASRLRERPESEPPLDWPKRKHIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLNDKKYETLVDADLQGNYNEEEVEQLIQVALLCTQSTPTERPKMSEVVRMLEGDGLAER

ProfileScan: PS50011
IPR000719
291-578 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSNKNILGRGGFGKVYKGRLADGSLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTLTERVLVYPYMENGSVASRLRERPESEPPLDWPKRKHIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLNDKKYETLVDADLQGNYNEEEVEQLIQVALLCTQSTPTERPKMSEVVRMLEGDGLAERWEEWQ

HMMPfam: PF00069
IPR000719
293-563 Pkinase,Ser-thr
Protein kinase, catalytic domain

NKNILGRGGFGKVYKGRLADGSLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTLTERVLVYPYMENGSVASRLRERPESEPPLDWPKRKHIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLNDKKYETLVDADLQGNYNEEEVEQLIQVALLCTQSTPTERPKMSEVVR

PatternScan: PS00107
IPR017441
297-319 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGGFGKVYKGRLADGSLVAVK

Gene3D: G3DSA:3.30.200.20
315-369 G3DSA:3.30.200.20

LVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTLTERVLVYPYME

Gene3D: G3DSA:1.10.510.10
370-565 G3DSA:1.10.510.10

NGSVASRLRERPESEPPLDWPKRKHIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLNDKKYETLVDADLQGNYNEEEVEQLIQVALLCTQSTPTERPKMSEVVRML

PatternScan: PS00108
IPR008271
414-426 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKAANILL


Diseases

Disease Pathogen Avirulence gene
Late blight Tobacco Phytophthora infestans

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox