PRGDB00061463 (Pikp-2)

From PRG Wiki
Revision as of 22:32, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Pikp-2
Gene Type Reference_R-Genes,_manually_curated
GenBank 319655781 (HM035360)
Gene Class CNL
Domain Type NBS, LRR, Others
Chromosome 11
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group resistance protein Pikp-1 (Pikp-1) and resistance protein Pikp-2 (Pikp-2) genes, complete cds.

DNA Sequence

GTATCTCATTGTAATCGATGACATTTGGCATTGGGAAGAATGGGAAGTCATCAGAAAGTCCATTCCCAAGAATGATCTGGGTGGTAGAATAATCATGACTACTCGTCTTAATTCAATAGCTGAGAAGTGCCACACTGATGACAATGATGTTTTTGTCTACGAAGTTGGGGATCTAGATAATAATGATGCTTTGTCGTTGTCTTGGGGGATAGCAACAAAGTCTGGGGCAGGCAACAGGATCGGAACTGGAGAGGATAATCCATGCTATGATATTGTGAACATGTGTTATGGTATGCCTTTAGCACTTATTTGGCTGTCGTCAGCATTGGTTGGAGAGATAGAAGAATTAGGTGGTGCTGAAGTGAAAAAATGTAGGGATTTGAGACACATAGAGGATGGTATTTTGGACATCCCATCCTTACAACCATTGGCGGAGAGTTTATGCCTTGGTTATAACCATCTTCCTCTTTATCTGAGGACTTTGTTGTTGTACTGTAGTGCATACCATTGGTCTAACAGAATCGAAAGGGGTCGTCTGGTCAGGAGGTGGATTGCGGAAGGATTTGTGTCGGAAGAGAAAGAAGCAGAAGGTTACTTTGGCGAGCTTATTAACAGAGGATGGATTACGCAGCACGGAGACAACAACAGTTATAATTACTATGAGATCCACCCCGTGATGCTGGCCTTCCTGAGATGCAAGTCCAAGGAGTACAATTTTTTAACATGCTTGGGTCTGGGATCTGATACTAGTACTAGTGCATCCTCCCCAAGGTTGATTCGCCGGCTGTCTCTTCAGGGGGGGTATCCAGTGGACTGCTTGTCAAGCATGAGTATGGATGTGTCACACACTTGCAGCCTTGTCGTCCTTGGTGACGTGGCGCGACCCAAGGGAATCCCCTTCTATATGTTTAAGCGCTTGCGAGTGTTGGACCTTGAAGATAATAAGGATATACAGGATTCTCATCTGCAGGGCATATGTGAACAGTTAAGCCTCAGAGTGAGGTACCTTGGTCTCAAGGGAACGCGGATCCGAAAGCTCCCTCAGGAGATGAGGAAGCTGAAGCATTTGGAGATTTTGTATGTGGGGAGCACTCGGATCAGTGAACTTCCGCAAGAGATTGGAGAGCTGAAGCATCTGCGGATTCTGGACGTGAGAAACACGGACATCACTGAGCTCCCACTGCAGATACGGGAGCTGCAGCATCTGCACACTCTGGACGTGAGGAACACTCCAATCAGTGAGCTCCCGCCGCAGGTTGGCAAGCTGCAGAATCTCAAGATTATGTGCGTGAGGAGCACTGGGGTTAGGGAGCTCCCAAAGGAGATTGGGGAGCTGAATCATCTACAGACTCTGGACGTGAGAAACACGAGGGTGAGAGAGCTGCCATGGCAAGCTGGCCAGATCTCCCAATCGTTGCGCGTGCTTGCCGGTGACAGTGGCGATGGCGTGCGGTTGCCCGAAGGCGTCTGCGAAGCTCTGATCAACGGTATTCCAGGGGCTACGCGTGCAAAATGCAGGGAGGTTCTGTCCATCGCGATCATCGATCGTTTCGGACCTCCCCTTGTTGGGATATTCAAAGTTCCCGGCAGTCATATGCGTATCCCGAAGATGATCAAAGACCACTTCCGCGTTCTTTCTTGCCTAGACATCAGGCTCTGCCACAAGCTTGAGGATGATGACCAAAAGTTCCTCGCCGAGATGCCCAACCTGCAGACGCTCGTGCTGAGGTTCGAGGCCCTACCAAGACAACCCATAACCATCAACGGCACAGGCTTCCAGATGCTGGAGAGCTTCCGTGTCGACAGCCGGGTGCCAAGGATAGCCTTCCATGAAGACGCCATGCCCAACCTCAAGCTTCTCGAGTTCAAGTTCTACGCCGGCCCAGCAAGCAACGATGCCATCGGCATCACCAACCTGAAGAGCCTCCAAAAGGTGGTCTTTCGGTGCTCGCCATGGTACAAGAGCGACGCCCCTGGCATCAGCGCCACCATTGACGTCGTGAAGAAAGAAGCCGAGGAGCATCCCAACCGGCCGATCACCCTCCTCATCAATGCTGGGTATAAGGAGATATCAACTGAGTCACACGGGAGCAGTGAAAACATTGCGGGCAGCAGTGGGATCGATACTGAGCCTGCACAGGCACAGCATGATAATCTCCCTGCTGTTCGAGATGACTACAAGGGAAAAGGGATTCTTCTTGATGGCAGGTGTCCTACCTGCGGCCGAGCGACTAAAATTGAAGAGGAAACCCAAGATCGAGTAGCAGATATTGAAATTCAAACAGAAACTACTAGCTAGCAAAAAATCGTGATCAAGGTTGCCATGGAGGGCAATAATTGCCGTTCAAAAGCAATGGCTTTAGTTGCGAGCACTGGAGGAGTGGACTCGGTTGCGCTCGTAGGTGATCTAAGAGACAAGATAGAGGTGGTCGGTTATGGCATTGACCCCATCAAGCTGATCTCCGCGCTCCGGAAGAAGGTGGGCGATGCGGAGTTGCTGCAGGTCAGCCAAGCAAATAAAGATGTGAAGGAGACGACGCCGATGCTTGCGCCGGTGAAATCCATATGTGAATTTCACAAGGTCAAAACAGTTTGCATCCTTGGATTGCCAGGTGGAGGCAAAACAACGGTTGCCAGAGAATTATATGACGCCTTGGGAACGCACTTCCCATGCCGGGTTTTCGTGTCAGTCTCTCCAAGTTCTAGTCCCAGTCCCAATCTCACAAAGACTCTTGCAGACATTTTCGCTCAAGCACAACTAGGAGTAACCGATACACTTAGCACATCATATGGTGGGAGTGGGACCGGGAGAGCTCTTCAACAACATCTCATCGACAACATATCAGCTTTCCTCCTCAACAAAAAATGGAGGCGGCTGCCATGGCCGTAACCGCAGCCACGGGGGCCTTGGCGCCCGTGCTAGTGAAGCTGGCCGCTTTGCTGGACGACGGGGAGTGCAATCTTCTGGAGGGGAGCCGGAGCGACGCAGAGTTCATCAGATCCGAGCTGGAGGCCGTTCATTCTCTCCTCACCCCAAATATCTTGGGGAGGATGGGGGATGACGATGCGGCGTGCAAGGATGGCTTGATTGCGGAGGTCCGGGAGCTGTCCTACGACCTGGATGATGCCGTCGACGACTTCTTGGAGCTCAATTTCGAGCAGCGAAGAAGCGCAAGCCCTTTCGGTGAGCTCAAGGCAAGAGTTGAGGAGCATGTCTCCAATCGCTTCTCTGACTGGAAGCTACCGGCGGCGAGCCTTCCGCCGTCGTCGGTACACCGCCGAGCTGGCTTGCCGCCACCAGATGCAGAGCTGGTGGGGATGGACAAACGTATGGAAGAGCTCACCAAATTGCTGGAACAAGGGAGCAATGATGCTTCACGATGGCGCAAGCGAAAACCGCATTTCCCGCTCAGAAAAACAGGGCTAAAG


Protein sequences

Name Description Sequence
resistance protein Pikp-1 resistance protein Pikp-1 [Oryza sativa Japonica Group].

MEAAAMAVTAATGALAPVLVKLAALLDDGECNLLEGSRSDAEFIRSELEAVHSLLTPNILGRMGDDDAACKDGLIAEVRELSYDLDDAVDDFLELNFEQRRSASPFGELKARVEEHVSNRFSDWKLPAASLPPSSVHRRAGLPPPDAELVGMDKRMEELTKLLEQGSNDASRWRKRKPHFPLRKTGLKQKIVIKVAMEGNNCRSKAMALVASTGGVDSVALVGDLRDKIEVVGYGIDPIKLISALRKKVGDAELLQVSQANKDVKETTPMLAPVKSICEFHKVKTVCILGLPGGGKTTVARELYDALGTHFPCRVFVSVSPSSSPSPNLTKTLADIFAQAQLGVTDTLSTSYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTTRLNSIAEKCHTDDNDVFVYEVGDLDNNDALSLSWGIATKSGAGNRIGTGEDNPCYDIVNMCYGMPLALIWLSSALVGEIEELGGAEVKKCRDLRHIEDGILDIPSLQPLAESLCLGYNHLPLYLRTLLLYCSAYHWSNRIERGRLVRRWIAEGFVSEEKEAEGYFGELINRGWITQHGDNNSYNYYEIHPVMLAFLRCKSKEYNFLTCLGLGSDTSTSASSPRLIRRLSLQGGYPVDCLSSMSMDVSHTCSLVVLGDVARPKGIPFYMFKRLRVLDLEDNKDIQDSHLQGICEQLSLRVRYLGLKGTRIRKLPQEMRKLKHLEILYVGSTRISELPQEIGELKHLRILDVRNTDITELPLQIRELQHLHTLDVRNTPISELPPQVGKLQNLKIMCVRSTGVRELPKEIGELNHLQTLDVRNTRVRELPWQAGQISQSLRVLAGDSGDGVRLPEGVCEALINGIPGATRAKCREVLSIAIIDRFGPPLVGIFKVPGSHMRIPKMIKDHFRVLSCLDIRLCHKLEDDDQKFLAEMPNLQTLVLRFEALPRQPITINGTGFQMLESFRVDSRVPRIAFHEDAMPNLKLLEFKFYAGPASNDAIGITNLKSLQKVVFRCSPWYKSDAPGISATIDVVKKEAEEHPNRPITLLINAGYKEISTESHGSSENIAGSSGIDTEPAQAQHDNLPAVRDDYKGKGILLDGRCPTCGRATKIEEETQDRVADIEIQTETTS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
11-1071 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ATGALAPVLVKLAALLDDGECNLLEGSRSDAEFIRSELEAVHSLLTPNILGRMGDDDAACKDGLIAEVRELSYDLDDAVDDFLELNFEQRRSASPFGELKARVEEHVSNRFSDWKLPAASLPPSSVHRRAGLPPPDAELVGMDKRMEELTKLLEQGSNDASRWRKRKPHFPLRKTGLKQKIVIKVAMEGNNCRSKAMALVASTGGVDSVALVGDLRDKIEVVGYGIDPIKLISALRKKVGDAELLQVSQANKDVKETTPMLAPVKSICEFHKVKTVCILGLPGGGKTTVARELYDALGTHFPCRVFVSVSPSSSPSPNLTKTLADIFAQAQLGVTDTLSTSYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTTRLNSIAEKCHTDDNDVFVYEVGDLDNNDALSLSWGIATKSGAGNRIGTGEDNPCYDIVNMCYGMPLALIWLSSALVGEIEELGGAEVKKCRDLRHIEDGILDIPSLQPLAESLCLGYNHLPLYLRTLLLYCSAYHWSNRIERGRLVRRWIAEGFVSEEKEAEGYFGELINRGWITQHGDNNSYNYYEIHPVMLAFLRCKSKEYNFLTCLGLGSDTSTSASSPRLIRRLSLQGGYPVDCLSSMSMDVSHTCSLVVLGDVARPKGIPFYMFKRLRVLDLEDNKDIQDSHLQGICEQLSLRVRYLGLKGTRIRKLPQEMRKLKHLEILYVGSTRISELPQEIGELKHLRILDVRNTDITELPLQIRELQHLHTLDVRNTPISELPPQVGKLQNLKIMCVRSTGVRELPKEIGELNHLQTLDVRNTRVRELPWQAGQISQSLRVLAGDSGDGVRLPEGVCEALINGIPGATRAKCREVLSIAIIDRFGPPLVGIFKVPGSHMRIPKMIKDHFRVLSCLDIRLCHKLEDDDQKFLAEMPNLQTLVLRFEALPRQPITINGTGFQMLESFRVDSRVPRIAFHEDAMPNLKLLEFKFYAGPASNDAIGITNLKSLQKVVFRCSPWYKSDAPGISATIDVVKKEAEEHPNRPITLLINAGYKEISTES

HMMPanther: PTHR23155:SF192
11-1071 PTHR23155:SF192,OS10G0132500 PROTEIN

ATGALAPVLVKLAALLDDGECNLLEGSRSDAEFIRSELEAVHSLLTPNILGRMGDDDAACKDGLIAEVRELSYDLDDAVDDFLELNFEQRRSASPFGELKARVEEHVSNRFSDWKLPAASLPPSSVHRRAGLPPPDAELVGMDKRMEELTKLLEQGSNDASRWRKRKPHFPLRKTGLKQKIVIKVAMEGNNCRSKAMALVASTGGVDSVALVGDLRDKIEVVGYGIDPIKLISALRKKVGDAELLQVSQANKDVKETTPMLAPVKSICEFHKVKTVCILGLPGGGKTTVARELYDALGTHFPCRVFVSVSPSSSPSPNLTKTLADIFAQAQLGVTDTLSTSYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTTRLNSIAEKCHTDDNDVFVYEVGDLDNNDALSLSWGIATKSGAGNRIGTGEDNPCYDIVNMCYGMPLALIWLSSALVGEIEELGGAEVKKCRDLRHIEDGILDIPSLQPLAESLCLGYNHLPLYLRTLLLYCSAYHWSNRIERGRLVRRWIAEGFVSEEKEAEGYFGELINRGWITQHGDNNSYNYYEIHPVMLAFLRCKSKEYNFLTCLGLGSDTSTSASSPRLIRRLSLQGGYPVDCLSSMSMDVSHTCSLVVLGDVARPKGIPFYMFKRLRVLDLEDNKDIQDSHLQGICEQLSLRVRYLGLKGTRIRKLPQEMRKLKHLEILYVGSTRISELPQEIGELKHLRILDVRNTDITELPLQIRELQHLHTLDVRNTPISELPPQVGKLQNLKIMCVRSTGVRELPKEIGELNHLQTLDVRNTRVRELPWQAGQISQSLRVLAGDSGDGVRLPEGVCEALINGIPGATRAKCREVLSIAIIDRFGPPLVGIFKVPGSHMRIPKMIKDHFRVLSCLDIRLCHKLEDDDQKFLAEMPNLQTLVLRFEALPRQPITINGTGFQMLESFRVDSRVPRIAFHEDAMPNLKLLEFKFYAGPASNDAIGITNLKSLQKVVFRCSPWYKSDAPGISATIDVVKKEAEEHPNRPITLLINAGYKEISTES

Gene3D: G3DSA:3.40.50.300
261-411 G3DSA:3.40.50.300

NKDVKETTPMLAPVKSICEFHKVKTVCILGLPGGGKTTVARELYDALGTHFPCRVFVSVSPSSSPSPNLTKTLADIFAQAQLGVTDTLSTSYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTT

superfamily: SSF52540
281-511 SSF52540

HKVKTVCILGLPGGGKTTVARELYDALGTHFPCRVFVSVSPSSSPSPNLTKTLADIFAQAQLGVTDTLSTSYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTTRLNSIAEKCHTDDNDVFVYEVGDLDNNDALSLSWGIATKSGAGNRIGTGEDNPCYDIVNMCYGMPLALIWLSSALVGEIEELGGAEVKKCRDLRHIEDGI

HMMPfam: PF00931
IPR002182
282-570 NB-ARC,NBS
NB-ARC

KVKTVCILGLPGGGKTTVARELYDALGTHFPCRVFVSVSPSSSPSPNLTKTLADIFAQAQLGVTDTLSTSYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTTRLNSIAEKCHTDDNDVFVYEVGDLDNNDALSLSWGIATKSGAGNRIGTGEDNPCYDIVNMCYGMPLALIWLSSALVGEIEELGGAEVKKCRDLRHIEDGILDIPSLQPLAESLCLGYNHLPLYLRTLLLYCSAYHWSNRIERGRLVRRWIAEGFVSEEK

HMMSmart: SM00382
IPR003593
282-428 AAA,NBS
AAA+ ATPase domain

KVKTVCILGLPGGGKTTVARELYDALGTHFPCRVFVSVSPSSSPSPNLTKTLADIFAQAQLGVTDTLSTSYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTTRLNSIAEKCHTDDNDVF

FPrintScan: PR00364
IPR000767
285-300 DISEASERSIST
Disease resistance protein

TVCILGLPGGGKTTVA

FPrintScan: PR00364
IPR000767
372-386 DISEASERSIST
Disease resistance protein

FLLNKKYLIVIDDIW

FPrintScan: PR00364
IPR000767
472-486 DISEASERSIST
Disease resistance protein

CYGMPLALIWLSSAL

Gene3D: G3DSA:3.80.10.10
513-535 G3DSA:3.80.10.10

DIPSLQPLAESLCLGYNHLPLYL

superfamily: SSF52047
638-1031 SSF52047,LRR

RLSLQGGYPVDCLSSMSMDVSHTCSLVVLGDVARPKGIPFYMFKRLRVLDLEDNKDIQDSHLQGICEQLSLRVRYLGLKGTRIRKLPQEMRKLKHLEILYVGSTRISELPQEIGELKHLRILDVRNTDITELPLQIRELQHLHTLDVRNTPISELPPQVGKLQNLKIMCVRSTGVRELPKEIGELNHLQTLDVRNTRVRELPWQAGQISQSLRVLAGDSGDGVRLPEGVCEALINGIPGATRAKCREVLSIAIIDRFGPPLVGIFKVPGSHMRIPKMIKDHFRVLSCLDIRLCHKLEDDDQKFLAEMPNLQTLVLRFEALPRQPITINGTGFQMLESFRVDSRVPRIAFHEDAMPNLKLLEFKFYAGPASNDAIGITNLKSLQKVVFRCSPWYK

Gene3D: G3DSA:3.80.10.10
676-872 G3DSA:3.80.10.10

PFYMFKRLRVLDLEDNKDIQDSHLQGICEQLSLRVRYLGLKGTRIRKLPQEMRKLKHLEILYVGSTRISELPQEIGELKHLRILDVRNTDITELPLQIRELQHLHTLDVRNTPISELPPQVGKLQNLKIMCVRSTGVRELPKEIGELNHLQTLDVRNTRVRELPWQAGQISQSLRVLAGDSGDGVRLPEGVCEALIN

FPrintScan: PR00364
IPR000767
678-694 DISEASERSIST
Disease resistance protein

YMFKRLRVLDLEDNKDI

HMMPfam: PF12799
755-794 LRR_4,Leucine Rich repeats (2 copies)

HLRILDVRNTDITELPLQIRELQHLHTLDVRNTPISELPP

Gene3D: G3DSA:3.80.10.10
925-979 G3DSA:3.80.10.10

LDIRLCHKLEDDDQKFLAEMPNLQTLVLRFEALPRQPITINGTGFQMLESFRVDS


Diseases

Disease Pathogen Avirulence gene
Rice blast disease Magnaporthe grisea

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox