PRGDB00061463 (Pikp-2)

From PRG Wiki
Revision as of 22:32, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Pikp-2
Gene Type Reference_R-Genes,_manually_curated
GenBank 319655781 (HM035360)
Gene Class CNL
Domain Type NBS, LRR, Others
Chromosome 11
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group resistance protein Pikp-1 (Pikp-1) and resistance protein Pikp-2 (Pikp-2) genes, complete cds.

DNA Sequence

GTATCTCATTGTAATCGATGACATTTGGCATTGGGAAGAATGGGAAGTCATCAGAAAGTCCATTCCCAAGAATGATCTGGGTGGTAGAATAATCATGACTACTCGTCTTAATTCAATAGCTGAGAAGTGCCACACTGATGACAATGATGTTTTTGTCTACGAAGTTGGGGATCTAGATAATAATGATGCTTTGTCGTTGTCTTGGGGGATAGCAACAAAGTCTGGGGCAGGCAACAGGATCGGAACTGGAGAGGATAATCCATGCTATGATATTGTGAACATGTGTTATGGTATGCCTTTAGCACTTATTTGGCTGTCGTCAGCATTGGTTGGAGAGATAGAAGAATTAGGTGGTGCTGAAGTGAAAAAATGTAGGGATTTGAGACACATAGAGGATGGTATTTTGGACATCCCATCCTTACAACCATTGGCGGAGAGTTTATGCCTTGGTTATAACCATCTTCCTCTTTATCTGAGGACTTTGTTGTTGTACTGTAGTGCATACCATTGGTCTAACAGAATCGAAAGGGGTCGTCTGGTCAGGAGGTGGATTGCGGAAGGATTTGTGTCGGAAGAGAAAGAAGCAGAAGGTTACTTTGGCGAGCTTATTAACAGAGGATGGATTACGCAGCACGGAGACAACAACAGTTATAATTACTATGAGATCCACCCCGTGATGCTGGCCTTCCTGAGATGCAAGTCCAAGGAGTACAATTTTTTAACATGCTTGGGTCTGGGATCTGATACTAGTACTAGTGCATCCTCCCCAAGGTTGATTCGCCGGCTGTCTCTTCAGGGGGGGTATCCAGTGGACTGCTTGTCAAGCATGAGTATGGATGTGTCACACACTTGCAGCCTTGTCGTCCTTGGTGACGTGGCGCGACCCAAGGGAATCCCCTTCTATATGTTTAAGCGCTTGCGAGTGTTGGACCTTGAAGATAATAAGGATATACAGGATTCTCATCTGCAGGGCATATGTGAACAGTTAAGCCTCAGAGTGAGGTACCTTGGTCTCAAGGGAACGCGGATCCGAAAGCTCCCTCAGGAGATGAGGAAGCTGAAGCATTTGGAGATTTTGTATGTGGGGAGCACTCGGATCAGTGAACTTCCGCAAGAGATTGGAGAGCTGAAGCATCTGCGGATTCTGGACGTGAGAAACACGGACATCACTGAGCTCCCACTGCAGATACGGGAGCTGCAGCATCTGCACACTCTGGACGTGAGGAACACTCCAATCAGTGAGCTCCCGCCGCAGGTTGGCAAGCTGCAGAATCTCAAGATTATGTGCGTGAGGAGCACTGGGGTTAGGGAGCTCCCAAAGGAGATTGGGGAGCTGAATCATCTACAGACTCTGGACGTGAGAAACACGAGGGTGAGAGAGCTGCCATGGCAAGCTGGCCAGATCTCCCAATCGTTGCGCGTGCTTGCCGGTGACAGTGGCGATGGCGTGCGGTTGCCCGAAGGCGTCTGCGAAGCTCTGATCAACGGTATTCCAGGGGCTACGCGTGCAAAATGCAGGGAGGTTCTGTCCATCGCGATCATCGATCGTTTCGGACCTCCCCTTGTTGGGATATTCAAAGTTCCCGGCAGTCATATGCGTATCCCGAAGATGATCAAAGACCACTTCCGCGTTCTTTCTTGCCTAGACATCAGGCTCTGCCACAAGCTTGAGGATGATGACCAAAAGTTCCTCGCCGAGATGCCCAACCTGCAGACGCTCGTGCTGAGGTTCGAGGCCCTACCAAGACAACCCATAACCATCAACGGCACAGGCTTCCAGATGCTGGAGAGCTTCCGTGTCGACAGCCGGGTGCCAAGGATAGCCTTCCATGAAGACGCCATGCCCAACCTCAAGCTTCTCGAGTTCAAGTTCTACGCCGGCCCAGCAAGCAACGATGCCATCGGCATCACCAACCTGAAGAGCCTCCAAAAGGTGGTCTTTCGGTGCTCGCCATGGTACAAGAGCGACGCCCCTGGCATCAGCGCCACCATTGACGTCGTGAAGAAAGAAGCCGAGGAGCATCCCAACCGGCCGATCACCCTCCTCATCAATGCTGGGTATAAGGAGATATCAACTGAGTCACACGGGAGCAGTGAAAACATTGCGGGCAGCAGTGGGATCGATACTGAGCCTGCACAGGCACAGCATGATAATCTCCCTGCTGTTCGAGATGACTACAAGGGAAAAGGGATTCTTCTTGATGGCAGGTGTCCTACCTGCGGCCGAGCGACTAAAATTGAAGAGGAAACCCAAGATCGAGTAGCAGATATTGAAATTCAAACAGAAACTACTAGCTAGCAAAAAATCGTGATCAAGGTTGCCATGGAGGGCAATAATTGCCGTTCAAAAGCAATGGCTTTAGTTGCGAGCACTGGAGGAGTGGACTCGGTTGCGCTCGTAGGTGATCTAAGAGACAAGATAGAGGTGGTCGGTTATGGCATTGACCCCATCAAGCTGATCTCCGCGCTCCGGAAGAAGGTGGGCGATGCGGAGTTGCTGCAGGTCAGCCAAGCAAATAAAGATGTGAAGGAGACGACGCCGATGCTTGCGCCGGTGAAATCCATATGTGAATTTCACAAGGTCAAAACAGTTTGCATCCTTGGATTGCCAGGTGGAGGCAAAACAACGGTTGCCAGAGAATTATATGACGCCTTGGGAACGCACTTCCCATGCCGGGTTTTCGTGTCAGTCTCTCCAAGTTCTAGTCCCAGTCCCAATCTCACAAAGACTCTTGCAGACATTTTCGCTCAAGCACAACTAGGAGTAACCGATACACTTAGCACATCATATGGTGGGAGTGGGACCGGGAGAGCTCTTCAACAACATCTCATCGACAACATATCAGCTTTCCTCCTCAACAAAAAATGGAGGCGGCTGCCATGGCCGTAACCGCAGCCACGGGGGCCTTGGCGCCCGTGCTAGTGAAGCTGGCCGCTTTGCTGGACGACGGGGAGTGCAATCTTCTGGAGGGGAGCCGGAGCGACGCAGAGTTCATCAGATCCGAGCTGGAGGCCGTTCATTCTCTCCTCACCCCAAATATCTTGGGGAGGATGGGGGATGACGATGCGGCGTGCAAGGATGGCTTGATTGCGGAGGTCCGGGAGCTGTCCTACGACCTGGATGATGCCGTCGACGACTTCTTGGAGCTCAATTTCGAGCAGCGAAGAAGCGCAAGCCCTTTCGGTGAGCTCAAGGCAAGAGTTGAGGAGCATGTCTCCAATCGCTTCTCTGACTGGAAGCTACCGGCGGCGAGCCTTCCGCCGTCGTCGGTACACCGCCGAGCTGGCTTGCCGCCACCAGATGCAGAGCTGGTGGGGATGGACAAACGTATGGAAGAGCTCACCAAATTGCTGGAACAAGGGAGCAATGATGCTTCACGATGGCGCAAGCGAAAACCGCATTTCCCGCTCAGAAAAACAGGGCTAAAG


Protein sequences

Name Description Sequence
resistance protein Pikp-1 resistance protein Pikp-1 [Oryza sativa Japonica Group].

MEAAAMAVTAATGALAPVLVKLAALLDDGECNLLEGSRSDAEFIRSELEAVHSLLTPNILGRMGDDDAACKDGLIAEVRELSYDLDDAVDDFLELNFEQRRSASPFGELKARVEEHVSNRFSDWKLPAASLPPSSVHRRAGLPPPDAELVGMDKRMEELTKLLEQGSNDASRWRKRKPHFPLRKTGLKQKIVIKVAMEGNNCRSKAMALVASTGGVDSVALVGDLRDKIEVVGYGIDPIKLISALRKKVGDAELLQVSQANKDVKETTPMLAPVKSICEFHKVKTVCILGLPGGGKTTVARELYDALGTHFPCRVFVSVSPSSSPSPNLTKTLADIFAQAQLGVTDTLSTSYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTTRLNSIAEKCHTDDNDVFVYEVGDLDNNDALSLSWGIATKSGAGNRIGTGEDNPCYDIVNMCYGMPLALIWLSSALVGEIEELGGAEVKKCRDLRHIEDGILDIPSLQPLAESLCLGYNHLPLYLRTLLLYCSAYHWSNRIERGRLVRRWIAEGFVSEEKEAEGYFGELINRGWITQHGDNNSYNYYEIHPVMLAFLRCKSKEYNFLTCLGLGSDTSTSASSPRLIRRLSLQGGYPVDCLSSMSMDVSHTCSLVVLGDVARPKGIPFYMFKRLRVLDLEDNKDIQDSHLQGICEQLSLRVRYLGLKGTRIRKLPQEMRKLKHLEILYVGSTRISELPQEIGELKHLRILDVRNTDITELPLQIRELQHLHTLDVRNTPISELPPQVGKLQNLKIMCVRSTGVRELPKEIGELNHLQTLDVRNTRVRELPWQAGQISQSLRVLAGDSGDGVRLPEGVCEALINGIPGATRAKCREVLSIAIIDRFGPPLVGIFKVPGSHMRIPKMIKDHFRVLSCLDIRLCHKLEDDDQKFLAEMPNLQTLVLRFEALPRQPITINGTGFQMLESFRVDSRVPRIAFHEDAMPNLKLLEFKFYAGPASNDAIGITNLKSLQKVVFRCSPWYKSDAPGISATIDVVKKEAEEHPNRPITLLINAGYKEISTESHGSSENIAGSSGIDTEPAQAQHDNLPAVRDDYKGKGILLDGRCPTCGRATKIEEETQDRVADIEIQTETTS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
11-1071 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ATGALAPVLVKLAALLDDGECNLLEGSRSDAEFIRSELEAVHSLLTPNILGRMGDDDAACKDGLIAEVRELSYDLDDAVDDFLELNFEQRRSASPFGELKARVEEHVSNRFSDWKLPAASLPPSSVHRRAGLPPPDAELVGMDKRMEELTKLLEQGSNDASRWRKRKPHFPLRKTGLKQKIVIKVAMEGNNCRSKAMALVASTGGVDSVALVGDLRDKIEVVGYGIDPIKLISALRKKVGDAELLQVSQANKDVKETTPMLAPVKSICEFHKVKTVCILGLPGGGKTTVARELYDALGTHFPCRVFVSVSPSSSPSPNLTKTLADIFAQAQLGVTDTLSTSYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTTRLNSIAEKCHTDDNDVFVYEVGDLDNNDALSLSWGIATKSGAGNRIGTGEDNPCYDIVNMCYGMPLALIWLSSALVGEIEELGGAEVKKCRDLRHIEDGILDIPSLQPLAESLCLGYNHLPLYLRTLLLYCSAYHWSNRIERGRLVRRWIAEGFVSEEKEAEGYFGELINRGWITQHGDNNSYNYYEIHPVMLAFLRCKSKEYNFLTCLGLGSDTSTSASSPRLIRRLSLQGGYPVDCLSSMSMDVSHTCSLVVLGDVARPKGIPFYMFKRLRVLDLEDNKDIQDSHLQGICEQLSLRVRYLGLKGTRIRKLPQEMRKLKHLEILYVGSTRISELPQEIGELKHLRILDVRNTDITELPLQIRELQHLHTLDVRNTPISELPPQVGKLQNLKIMCVRSTGVRELPKEIGELNHLQTLDVRNTRVRELPWQAGQISQSLRVLAGDSGDGVRLPEGVCEALINGIPGATRAKCREVLSIAIIDRFGPPLVGIFKVPGSHMRIPKMIKDHFRVLSCLDIRLCHKLEDDDQKFLAEMPNLQTLVLRFEALPRQPITINGTGFQMLESFRVDSRVPRIAFHEDAMPNLKLLEFKFYAGPASNDAIGITNLKSLQKVVFRCSPWYKSDAPGISATIDVVKKEAEEHPNRPITLLINAGYKEISTES

HMMPanther: PTHR23155:SF192
11-1071 PTHR23155:SF192,OS10G0132500 PROTEIN

ATGALAPVLVKLAALLDDGECNLLEGSRSDAEFIRSELEAVHSLLTPNILGRMGDDDAACKDGLIAEVRELSYDLDDAVDDFLELNFEQRRSASPFGELKARVEEHVSNRFSDWKLPAASLPPSSVHRRAGLPPPDAELVGMDKRMEELTKLLEQGSNDASRWRKRKPHFPLRKTGLKQKIVIKVAMEGNNCRSKAMALVASTGGVDSVALVGDLRDKIEVVGYGIDPIKLISALRKKVGDAELLQVSQANKDVKETTPMLAPVKSICEFHKVKTVCILGLPGGGKTTVARELYDALGTHFPCRVFVSVSPSSSPSPNLTKTLADIFAQAQLGVTDTLSTSYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTTRLNSIAEKCHTDDNDVFVYEVGDLDNNDALSLSWGIATKSGAGNRIGTGEDNPCYDIVNMCYGMPLALIWLSSALVGEIEELGGAEVKKCRDLRHIEDGILDIPSLQPLAESLCLGYNHLPLYLRTLLLYCSAYHWSNRIERGRLVRRWIAEGFVSEEKEAEGYFGELINRGWITQHGDNNSYNYYEIHPVMLAFLRCKSKEYNFLTCLGLGSDTSTSASSPRLIRRLSLQGGYPVDCLSSMSMDVSHTCSLVVLGDVARPKGIPFYMFKRLRVLDLEDNKDIQDSHLQGICEQLSLRVRYLGLKGTRIRKLPQEMRKLKHLEILYVGSTRISELPQEIGELKHLRILDVRNTDITELPLQIRELQHLHTLDVRNTPISELPPQVGKLQNLKIMCVRSTGVRELPKEIGELNHLQTLDVRNTRVRELPWQAGQISQSLRVLAGDSGDGVRLPEGVCEALINGIPGATRAKCREVLSIAIIDRFGPPLVGIFKVPGSHMRIPKMIKDHFRVLSCLDIRLCHKLEDDDQKFLAEMPNLQTLVLRFEALPRQPITINGTGFQMLESFRVDSRVPRIAFHEDAMPNLKLLEFKFYAGPASNDAIGITNLKSLQKVVFRCSPWYKSDAPGISATIDVVKKEAEEHPNRPITLLINAGYKEISTES

Gene3D: G3DSA:3.40.50.300
261-411 G3DSA:3.40.50.300

NKDVKETTPMLAPVKSICEFHKVKTVCILGLPGGGKTTVARELYDALGTHFPCRVFVSVSPSSSPSPNLTKTLADIFAQAQLGVTDTLSTSYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTT

superfamily: SSF52540
281-511 SSF52540

HKVKTVCILGLPGGGKTTVARELYDALGTHFPCRVFVSVSPSSSPSPNLTKTLADIFAQAQLGVTDTLSTSYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTTRLNSIAEKCHTDDNDVFVYEVGDLDNNDALSLSWGIATKSGAGNRIGTGEDNPCYDIVNMCYGMPLALIWLSSALVGEIEELGGAEVKKCRDLRHIEDGI

HMMPfam: PF00931
IPR002182
282-570 NB-ARC,NBS
NB-ARC

KVKTVCILGLPGGGKTTVARELYDALGTHFPCRVFVSVSPSSSPSPNLTKTLADIFAQAQLGVTDTLSTSYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTTRLNSIAEKCHTDDNDVFVYEVGDLDNNDALSLSWGIATKSGAGNRIGTGEDNPCYDIVNMCYGMPLALIWLSSALVGEIEELGGAEVKKCRDLRHIEDGILDIPSLQPLAESLCLGYNHLPLYLRTLLLYCSAYHWSNRIERGRLVRRWIAEGFVSEEK

HMMSmart: SM00382
IPR003593
282-428 AAA,NBS
AAA+ ATPase domain

KVKTVCILGLPGGGKTTVARELYDALGTHFPCRVFVSVSPSSSPSPNLTKTLADIFAQAQLGVTDTLSTSYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTTRLNSIAEKCHTDDNDVF

FPrintScan: PR00364
IPR000767
285-300 DISEASERSIST
Disease resistance protein

TVCILGLPGGGKTTVA

FPrintScan: PR00364
IPR000767
372-386 DISEASERSIST
Disease resistance protein

FLLNKKYLIVIDDIW

FPrintScan: PR00364
IPR000767
472-486 DISEASERSIST
Disease resistance protein

CYGMPLALIWLSSAL

Gene3D: G3DSA:3.80.10.10
513-535 G3DSA:3.80.10.10

DIPSLQPLAESLCLGYNHLPLYL

superfamily: SSF52047
638-1031 SSF52047,LRR

RLSLQGGYPVDCLSSMSMDVSHTCSLVVLGDVARPKGIPFYMFKRLRVLDLEDNKDIQDSHLQGICEQLSLRVRYLGLKGTRIRKLPQEMRKLKHLEILYVGSTRISELPQEIGELKHLRILDVRNTDITELPLQIRELQHLHTLDVRNTPISELPPQVGKLQNLKIMCVRSTGVRELPKEIGELNHLQTLDVRNTRVRELPWQAGQISQSLRVLAGDSGDGVRLPEGVCEALINGIPGATRAKCREVLSIAIIDRFGPPLVGIFKVPGSHMRIPKMIKDHFRVLSCLDIRLCHKLEDDDQKFLAEMPNLQTLVLRFEALPRQPITINGTGFQMLESFRVDSRVPRIAFHEDAMPNLKLLEFKFYAGPASNDAIGITNLKSLQKVVFRCSPWYK

Gene3D: G3DSA:3.80.10.10
676-872 G3DSA:3.80.10.10

PFYMFKRLRVLDLEDNKDIQDSHLQGICEQLSLRVRYLGLKGTRIRKLPQEMRKLKHLEILYVGSTRISELPQEIGELKHLRILDVRNTDITELPLQIRELQHLHTLDVRNTPISELPPQVGKLQNLKIMCVRSTGVRELPKEIGELNHLQTLDVRNTRVRELPWQAGQISQSLRVLAGDSGDGVRLPEGVCEALIN

FPrintScan: PR00364
IPR000767
678-694 DISEASERSIST
Disease resistance protein

YMFKRLRVLDLEDNKDI

HMMPfam: PF12799
755-794 LRR_4,Leucine Rich repeats (2 copies)

HLRILDVRNTDITELPLQIRELQHLHTLDVRNTPISELPP

Gene3D: G3DSA:3.80.10.10
925-979 G3DSA:3.80.10.10

LDIRLCHKLEDDDQKFLAEMPNLQTLVLRFEALPRQPITINGTGFQMLESFRVDS


Diseases

Disease Pathogen Avirulence gene
Rice blast disease Magnaporthe grisea

List of References

Bin Yuan, Chun Zhai, Wenjuan Wang, Xiaoshan Zeng, Xiaoke Xu, Hanqiao Hu, Fei Lin, Ling Wang, Qinghua Pan
The Pik-p resistance to Magnaporthe oryzae in rice is mediated by a pair of closely linked CC-NBS-LRR genes.
Theor. Appl. Genet.: 2011, 122(5);1017-28
PubMed:21153625 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox