PRGDB00061464 (KR1)

From PRG Wiki
Jump to: navigation, search
KR1
Gene Type Reference_R-Genes,_manually_curated
GenBank 18033110 (AF327903)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Glycine max

Comment?

Glycine max functional candidate resistance protein KR1 (KR1) mRNA, complete cds.

DNA Sequence

ATGGCTAAGCAATCATCCTCATCTTCCTTTAGTTACAGATTCAGCAACGATGTGTTCCTCAGCTTCCGAGGGGAAGATACTCGTCGCGGTTTTACTGGCAATCTCTATAAAGCTCTCTCTGACAGGGGAATTCACACCTTCATGGATGACAAGAAGATCCCTAGAGGAGACCAAATCACCTCAGGACTTGAGAAGGCAATTGAAGAGTCCAGAATATTCATCATCGTGCTCTCTGAAAACTATGCATCGTCCTCCTTCTGCTTAAACGAACTTGATTACATCCTTAAGTTTATTAAGGGGAAGGGCATATTGATTTTGCCAGTTTTTTATAAGGTTGACCCTTCTGATGTGAGAAACCACACTGGTAGTTTTGGAAAGGCGTTGACTAATCATGAAAAGAAGTTCAAAAGTACTAATGACATGGAGAAGCTGGAAACATGGAAGATGGCTCTGAACAAAGTGGCTAATTTATCTGGTTACCATCATTTCAAACATGGGGAAGAATACGAATATGAATTTATTCAGAGGATTGTTGAGTTGGTCTCTAAGAAGATTAATCGTGCTCCTTTACATGTTGCGGATTATCCAGTTGGACTAGAGTCACGAATACAAGAAGTAAAAGCGCTTCTGGATGTTGGATCTGATGATGTTGTCCACATGCTGGGTATACATGGGCTCGGTGGAGTAGGTAAAACGACACTTGCTGCTGCAGTTTATAATTCCATTGCTGACCATTTTGAAGCTTTGTGTTTCCTTCAAAACGTGAGAGAAACTTCAAAGAAACATGGGTTACAACATCTACAAAGAAACCTTCTTTCTGAAATGGCCGGAGAGGATAAGTTAATAGGTGTCAAACAAGGAATTTCCATAATAGAGCATAGGCTCCGGCAAAAGAAGGTTCTTTTGATTCTCGATGATGTTGACAAAAGGGAACAGCTACAGGCGCTTGCTGGAAGACCTGATTTGTTTGGTCCTGGCAGTAGAGTCATCATCACGACTCGGGACAAACAATTGCTAGCATGTCACGGTGTTGAAAGAACATATGAGGTGAATGAATTGAATGAGGAATATGCTCTTGAGTTACTTAATTGGAAAGCTTTCAAGTTGGAAAAAGTTGATCCATTTTACAAGGATGTTTTGAATCGAGCAGCAACTTATGCTTCAGGCCTTCCATTGGCTTTAGAAGTAATAGGTTCCAACTTATCCGGAAAAAATATAGAACAATGGATATCTGCTTTAGATCGATACAAAAGAATCCCTAATAAAGAGATCCAAGAGATACTTAAAGTGAGTTATGATGCTTTGGAAGAGGATGAGCAAAGTATTTTTCTTGACATTGCTTGTTGCTTCAAAAAATATGATTTGGCAGAGGTCCAAGATATACTTCATGCTCATCATGGCCATTGCATGAAACATCATATTGGAGTGTTGGTTGAAAAATCTCTCATAAAGATTAGTTTGGATGGCTATGTTACACTACATGACTTGATAGAGGACATGGGTAAAGAAATTGTCCGGAAAGAATCTCCCCAAGAGCCTGGGAAACGTAGTAGGTTATGGCTACCTACAGATATAGTTCAAGTTTTAGAAGAGAACAAGGGAACTAGTCATATTGGAATCATATGCATGAATTTCTACTCCTCATTTGAAGAAGTAGAAATACAGTGGGATGGAGATGCCTTCAAAAAGATGAAAAATCTCAAGACACTTATTATCAGAAGTGGTCATTTCTCCAAAGGTCCCAAACATTTTCCTAAGAGTTTAAGAGTATTGGAATGGTGGAGATATCCTTCACATTATTTTCCATATGATTTTCAAATGGAGAAGCTTGCTATATTCAACTTACCCGACTGTGGGTTTACTTCACGTGAGTTGGCTGCCATGTTAAAAAAGAAGTTTGTGAATCTGACAAGTCTAAATTTTGACTCATGTCAACATTTAACACTGATACCTGATGTATCTTGTGTCCCACATTTGCAAAAATTGTCATTTAAAGATTGTGATAATTTATATGCCATTCACCCGTCAGTAGGCTTCTTGGAAAAACTGAGAATCTTGGACGCAGAAGGTTGCTCCAGGCTTAAGAATTTCCCCCCCATCAAGTTGACCTCTCTTGAGCAACTCAAACTTGGGTTTTGTCACAGCCTTGAGAATTTTCCAGAAATATTAGGAAAGATGGAAAACATAACAGAACTTGACTTGGAACAAACTCCTGTAAAAAAATTCCCTCTTTCATTTCAAAATCTTACTCGGCTTGAAACTGTACTTCTGTGTTTCCCTCGAAACCAGGCAAACGGTTGTACTGGCATTTTCCTTTCGAACATTTGCCCGATGCAAGAAAGCCCGGAACTGATCAATGTCATAGGTGTGGGATGGGAAGGGTGTCTATTCCGTAAAGAGGATGAGGGTGCAGAGAATGTGAGCTTAACCACATCTTCAAACGTTCAATTTCTTGATCTCAGAAACTGCAACCTGTCAGATGATTTTTTTCCGATAGCTCTCCCATGCTTTGCTAATGTAATGGAGTTAAACCTATCAGGGAATAATTTCACAGTTATTCCCGAATGCATCAAAGAATGCCGCTTTTTAACAACACTTTACTTGAATTATTGTGAGCGACTTCGAGAAATTAGAGGGATTCCTCCAAACTTGAAATATTTCTATGCAGAAGAATGCCTATCATTGACTTCCTCATGTAGAAGCATGTTACTCAGTCAGGAACTGCATGAGGCTGGAAGAACCTTCTTCTATTTGCCAGGAGCCAAGATTCCAGAGTGGTTTGATTTCCAAACATCGGAATTTCCAATTTCTTTCTGGTTTCGTAACAAATTCCCAGCCATTGCTATTTGTCATATTATCAAACGGGTGGCTGAGTTTTCCTCATCGAGAGGTTGGACATTTAGACCCAACATTAGAACCAAGGTGATCATCAATGGCAATGCAAATTTGTTTAACTCTGTGGTGTTGGGAAGTGATTGTACATGTCTTTTTGATCTGCGGGGTGAAAGAGTAACAGATAATTTAGATGAAGCACTTTTAGAAAATGAATGGAACCATGCAGAAGTTACATGTCCAGGTTTTACTTTTACTTTTGCCCCAACCTTTATAAAAACTGGACTACATGTATTGAAACAGGAAAGTAACATGGAGGATATTCGATTCTCTGATCCTTGTAGAAAAACAAAATTGGATAATGATTTCAATAGTTCAAAACCAAAAAATCAAAGATGGGTGGGCAATGATGTTGCCAAGACACAAGTTGTGCAGCAGCAACAACTTATGGGCTCTTTTTTGTCACGCATGTGGCACTGGGCACTAGTGTTTCTCATTTCTTTCCTAGTGTTTCTCATTTCTTGCCGCCGCAACAATCAATGA


Protein sequences

Name Description Sequence
functional candidate resistance protein KR1 functional candidate resistance protein KR1 [Glycine max].

MAKQSSSSSFSYRFSNDVFLSFRGEDTRRGFTGNLYKALSDRGIHTFMDDKKIPRGDQITSGLEKAIEESRIFIIVLSENYASSSFCLNELDYILKFIKGKGILILPVFYKVDPSDVRNHTGSFGKALTNHEKKFKSTNDMEKLETWKMALNKVANLSGYHHFKHGEEYEYEFIQRIVELVSKKINRAPLHVADYPVGLESRIQEVKALLDVGSDDVVHMLGIHGLGGVGKTTLAAAVYNSIADHFEALCFLQNVRETSKKHGLQHLQRNLLSEMAGEDKLIGVKQGISIIEHRLRQKKVLLILDDVDKREQLQALAGRPDLFGPGSRVIITTRDKQLLACHGVERTYEVNELNEEYALELLNWKAFKLEKVDPFYKDVLNRAATYASGLPLALEVIGSNLSGKNIEQWISALDRYKRIPNKEIQEILKVSYDALEEDEQSIFLDIACCFKKYDLAEVQDILHAHHGHCMKHHIGVLVEKSLIKISLDGYVTLHDLIEDMGKEIVRKESPQEPGKRSRLWLPTDIVQVLEENKGTSHIGIICMNFYSSFEEVEIQWDGDAFKKMKNLKTLIIRSGHFSKGPKHFPKSLRVLEWWRYPSHYFPYDFQMEKLAIFNLPDCGFTSRELAAMLKKKFVNLTSLNFDSCQHLTLIPDVSCVPHLQKLSFKDCDNLYAIHPSVGFLEKLRILDAEGCSRLKNFPPIKLTSLEQLKLGFCHSLENFPEILGKMENITELDLEQTPVKKFPLSFQNLTRLETVLLCFPRNQANGCTGIFLSNICPMQESPELINVIGVGWEGCLFRKEDEGAENVSLTTSSNVQFLDLRNCNLSDDFFPIALPCFANVMELNLSGNNFTVIPECIKECRFLTTLYLNYCERLREIRGIPPNLKYFYAEECLSLTSSCRSMLLSQELHEAGRTFFYLPGAKIPEWFDFQTSEFPISFWFRNKFPAIAICHIIKRVAEFSSSRGWTFRPNIRTKVIINGNANLFNSVVLGSDCTCLFDLRGERVTDNLDEALLENEWNHAEVTCPGFTFTFAPTFIKTGLHVLKQESNMEDIRFSDPCRKTKLDNDFNSSKPKNQRWVGNDVAKTQVVQQQQLMGSFLSRMWHWALVFLISFLVFLISCRRNNQ

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
4-160 TIR
Toll/interleukin-1 receptor homology (TIR) domain

QSSSSSFSYRFSNDVFLSFRGEDTRRGFTGNLYKALSDRGIHTFMDDKKIPRGDQITSGLEKAIEESRIFIIVLSENYASSSFCLNELDYILKFIKGKGILILPVFYKVDPSDVRNHTGSFGKALTNHEKKFKSTNDMEKLETWKMALNKVANLSGY

ProfileScan: PS50104
IPR000157
14-157 TIR
Toll/interleukin-1 receptor homology (TIR) domain

FSNDVFLSFRGEDTRRGFTGNLYKALSDRGIHTFMDDKKIPRGDQITSGLEKAIEESRIFIIVLSENYASSSFCLNELDYILKFIKGKGILILPVFYKVDPSDVRNHTGSFGKALTNHEKKFKSTNDMEKLETWKMALNKVANL

HMMSmart: SM00255
IPR000157
15-157 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SNDVFLSFRGEDTRRGFTGNLYKALSDRGIHTFMDDKKIPRGDQITSGLEKAIEESRIFIIVLSENYASSSFCLNELDYILKFIKGKGILILPVFYKVDPSDVRNHTGSFGKALTNHEKKFKSTNDMEKLETWKMALNKVANL

Gene3D: G3DSA:3.40.50.10140
16-148 G3DSA:3.40.50.10140

NDVFLSFRGEDTRRGFTGNLYKALSDRGIHTFMDDKKIPRGDQITSGLEKAIEESRIFIIVLSENYASSSFCLNELDYILKFIKGKGILILPVFYKVDPSDVRNHTGSFGKALTNHEKKFKSTNDMEKLETWK

HMMPfam: PF01582
IPR000157
18-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDTRRGFTGNLYKALSDRGIHTFMDDKKIPRGDQITSGLEKAIEESRIFIIVLSENYASSSFCLNELDYILKFIKGKGILILPVFYKVDPSDVRNHTGSFGKALTNHEKKFKSTNDMEKLETWKMALN

HMMPanther: PTHR11017
46-892 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TFMDDKKIPRGDQITSGLEKAIEESRIFIIVLSENYASSSFCLNELDYILKFIKGKGILILPVFYKVDPSDVRNHTGSFGKALTNHEKKFKSTNDMEKLETWKMALNKVANLSGYHHFKHGEEYEYEFIQRIVELVSKKINRAPLHVADYPVGLESRIQEVKALLDVGSDDVVHMLGIHGLGGVGKTTLAAAVYNSIADHFEALCFLQNVRETSKKHGLQHLQRNLLSEMAGEDKLIGVKQGISIIEHRLRQKKVLLILDDVDKREQLQALAGRPDLFGPGSRVIITTRDKQLLACHGVERTYEVNELNEEYALELLNWKAFKLEKVDPFYKDVLNRAATYASGLPLALEVIGSNLSGKNIEQWISALDRYKRIPNKEIQEILKVSYDALEEDEQSIFLDIACCFKKYDLAEVQDILHAHHGHCMKHHIGVLVEKSLIKISLDGYVTLHDLIEDMGKEIVRKESPQEPGKRSRLWLPTDIVQVLEENKGTSHIGIICMNFYSSFEEVEIQWDGDAFKKMKNLKTLIIRSGHFSKGPKHFPKSLRVLEWWRYPSHYFPYDFQMEKLAIFNLPDCGFTSRELAAMLKKKFVNLTSLNFDSCQHLTLIPDVSCVPHLQKLSFKDCDNLYAIHPSVGFLEKLRILDAEGCSRLKNFPPIKLTSLEQLKLGFCHSLENFPEILGKMENITELDLEQTPVKKFPLSFQNLTRLETVLLCFPRNQANGCTGIFLSNICPMQESPELINVIGVGWEGCLFRKEDEGAENVSLTTSSNVQFLDLRNCNLSDDFFPIALPCFANVMELNLSGNNFTVIPECIKECRFLTTLYLNYCERLREIRGIPPNLKYFYAEEC

HMMPanther: PTHR11017:SF20
46-892 PTHR11017:SF20,SUBFAMILY NOT NAMED

TFMDDKKIPRGDQITSGLEKAIEESRIFIIVLSENYASSSFCLNELDYILKFIKGKGILILPVFYKVDPSDVRNHTGSFGKALTNHEKKFKSTNDMEKLETWKMALNKVANLSGYHHFKHGEEYEYEFIQRIVELVSKKINRAPLHVADYPVGLESRIQEVKALLDVGSDDVVHMLGIHGLGGVGKTTLAAAVYNSIADHFEALCFLQNVRETSKKHGLQHLQRNLLSEMAGEDKLIGVKQGISIIEHRLRQKKVLLILDDVDKREQLQALAGRPDLFGPGSRVIITTRDKQLLACHGVERTYEVNELNEEYALELLNWKAFKLEKVDPFYKDVLNRAATYASGLPLALEVIGSNLSGKNIEQWISALDRYKRIPNKEIQEILKVSYDALEEDEQSIFLDIACCFKKYDLAEVQDILHAHHGHCMKHHIGVLVEKSLIKISLDGYVTLHDLIEDMGKEIVRKESPQEPGKRSRLWLPTDIVQVLEENKGTSHIGIICMNFYSSFEEVEIQWDGDAFKKMKNLKTLIIRSGHFSKGPKHFPKSLRVLEWWRYPSHYFPYDFQMEKLAIFNLPDCGFTSRELAAMLKKKFVNLTSLNFDSCQHLTLIPDVSCVPHLQKLSFKDCDNLYAIHPSVGFLEKLRILDAEGCSRLKNFPPIKLTSLEQLKLGFCHSLENFPEILGKMENITELDLEQTPVKKFPLSFQNLTRLETVLLCFPRNQANGCTGIFLSNICPMQESPELINVIGVGWEGCLFRKEDEGAENVSLTTSSNVQFLDLRNCNLSDDFFPIALPCFANVMELNLSGNNFTVIPECIKECRFLTTLYLNYCERLREIRGIPPNLKYFYAEEC

superfamily: SSF52540
179-424 SSF52540

ELVSKKINRAPLHVADYPVGLESRIQEVKALLDVGSDDVVHMLGIHGLGGVGKTTLAAAVYNSIADHFEALCFLQNVRETSKKHGLQHLQRNLLSEMAGEDKLIGVKQGISIIEHRLRQKKVLLILDDVDKREQLQALAGRPDLFGPGSRVIITTRDKQLLACHGVERTYEVNELNEEYALELLNWKAFKLEKVDPFYKDVLNRAATYASGLPLALEVIGSNLSGKNIEQWISALDRYKRIPNKEI

Gene3D: G3DSA:3.40.50.300
198-309 G3DSA:3.40.50.300

GLESRIQEVKALLDVGSDDVVHMLGIHGLGGVGKTTLAAAVYNSIADHFEALCFLQNVRETSKKHGLQHLQRNLLSEMAGEDKLIGVKQGISIIEHRLRQKKVLLILDDVDK

HMMPfam: PF00931
IPR002182
200-457 NB-ARC,NBS
NB-ARC

ESRIQEVKALLDVGSDDVVHMLGIHGLGGVGKTTLAAAVYNSIADHFEALCFLQNVRETSKKHGLQHLQRNLLSEMAGEDKLIGVKQGISIIEHRLRQKKVLLILDDVDKREQLQALAGRPDLFGPGSRVIITTRDKQLLACHGVERTYEVNELNEEYALELLNWKAFKLEKVDPFYKDVLNRAATYASGLPLALEVIGSNLSGKNIEQWISALDRYKRIPNKEIQEILKVSYDALEEDEQSIFLDIACCFKKYDLAE

FPrintScan: PR00364
IPR000767
220-235 DISEASERSIST
Disease resistance protein

MLGIHGLGGVGKTTLA

FPrintScan: PR00364
IPR000767
294-308 DISEASERSIST
Disease resistance protein

RLRQKKVLLILDDVD

FPrintScan: PR00364
IPR000767
387-401 DISEASERSIST
Disease resistance protein

ASGLPLALEVIGSNL

superfamily: SSF46785
422-530 SSF46785

KEIQEILKVSYDALEEDEQSIFLDIACCFKKYDLAEVQDILHAHHGHCMKHHIGVLVEKSLIKISLDGYVTLHDLIEDMGKEIVRKESPQEPGKRSRLWLPTDIVQVLE

Gene3D: G3DSA:1.10.10.10
IPR011991
424-494 Wing_hlx_DNA_bd
Winged helix-turn-helix transcription repressor DN

IQEILKVSYDALEEDEQSIFLDIACCFKKYDLAEVQDILHAHHGHCMKHHIGVLVEKSLIKISLDGYVTLH

superfamily: SSF52058
504-912 SSF52058,LRR

IVRKESPQEPGKRSRLWLPTDIVQVLEENKGTSHIGIICMNFYSSFEEVEIQWDGDAFKKMKNLKTLIIRSGHFSKGPKHFPKSLRVLEWWRYPSHYFPYDFQMEKLAIFNLPDCGFTSRELAAMLKKKFVNLTSLNFDSCQHLTLIPDVSCVPHLQKLSFKDCDNLYAIHPSVGFLEKLRILDAEGCSRLKNFPPIKLTSLEQLKLGFCHSLENFPEILGKMENITELDLEQTPVKKFPLSFQNLTRLETVLLCFPRNQANGCTGIFLSNICPMQESPELINVIGVGWEGCLFRKEDEGAENVSLTTSSNVQFLDLRNCNLSDDFFPIALPCFANVMELNLSGNNFTVIPECIKECRFLTTLYLNYCERLREIRGIPPNLKYFYAEECLSLTSSCRSMLLSQELHEAG

Gene3D: G3DSA:3.80.10.10
558-757 G3DSA:3.80.10.10

GDAFKKMKNLKTLIIRSGHFSKGPKHFPKSLRVLEWWRYPSHYFPYDFQMEKLAIFNLPDCGFTSRELAAMLKKKFVNLTSLNFDSCQHLTLIPDVSCVPHLQKLSFKDCDNLYAIHPSVGFLEKLRILDAEGCSRLKNFPPIKLTSLEQLKLGFCHSLENFPEILGKMENITELDLEQTPVKKFPLSFQNLTRLETVLL

FPrintScan: PR00364
IPR000767
678-694 DISEASERSIST
Disease resistance protein

GFLEKLRILDAEGCSRL

Gene3D: G3DSA:3.80.10.10
812-896 G3DSA:3.80.10.10

SSNVQFLDLRNCNLSDDFFPIALPCFANVMELNLSGNNFTVIPECIKECRFLTTLYLNYCERLREIRGIPPNLKYFYAEECLSLT

HMMPfam: PF00560
IPR001611
814-838 LRR_1
Leucine-rich repeat

NVQFLDLRNCNLSDDFFPIALPCFA

HMMPfam: PF00560
IPR001611
841-858 LRR_1
Leucine-rich repeat

MELNLSGNNFTVIPECIK


Diseases

Disease Pathogen Avirulence gene
Soybean mosaic virus

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox