PRGDB00061465 (FOM-2)

From PRG Wiki
Revision as of 22:32, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
FOM-2
Gene Type Reference_R-Genes,_manually_curated
GenBank 82794017 (DQ287965)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Cucumis melo

Comment?

Cucumis melo R-FOM-2 gene, complete cds.

DNA Sequence

ATGGGTGATTTCCTATGGACTTTTGCTGTGGAAGAAATGTTGAAGAAGGTGTTGAAGGTTGCACGGGAGCAAACTGGCCTAGCATGGGGCTTCCAGAAACATCTCTCCAAGCTCCAAAAATGGCTACTCAAGGCTGAAGCTTTCTTACGCAATATCAACACGAGAAAATTACATCATGATTCTGTGAGGATGTGGGTGGATGATCTTCGGCATCTTGTTTATCAAGCCGATGATCTATTAGACGAAATTGTTTATGAAGATCTTCGACAAAAGGTCCAAACAAGAAAAATGAAGAAGGTGTGTGATTTTTTTTCTCCTTCTACCAATGTTTTGATCTTTCGTCTTAACATGGCAAAAAAAATGATGACTCTTATAGCATTGTTAGAAAAGCATTACCTTGAGGCTGCTCCTTTAGGACTTGTGGGGAATGAAAATGTAAGTCCAGAGATCGATGTTATTAGTCAATATCGAGAGACAATTTCAGAACTCGAAGATCATAAGATTTTGGGGAGGGATGTTGAAGTTGAAAGTATAGTGAAACAAGTGATTGATGCTAGCAATAATCAACTTACATCTATCCTACCCATTGTTGGTATGGGTGGATTAGGAAAAACAACTTTGGCAAAGTTAGTTTTCAAACACGAGTTGGTTAGACAACATTTTGATAAAACTGTATGGGTATGTGTCTCTGAACCATTTATTGTCAACAAGATTTTGTTAGATATTTTACAAAATCTAAAAGGTGGCATTTCTAATGGAGGGGATAGTAAGGAGGTTTTACTTCGTGAACTCCAAAAAGAAATGCTTGGGCAAACATATTTTCTTGTGCTTGACGATGTTTGGAACGAAAATTCTTTTCTATGGGGTGAGTTGAAATATTGTTTGCTCAAGATCACTGGAAACTCTAAAAATAGTATTGTTGTGACTACAAGGAGTGCTGAAGTTACAAAAATCATGGGAACATGTCCTGGTCATCTTTTAAGTAAATTATCTGATGATCATTGTTGGTCCTTGTTTAAAGAAAGTGCAAATGTATATGGACTATCAATGACTTCAAACTTGGGGATTATTCAAAAAGAGTTGGTCAAAAAAATTGGTGGTGTACCATTGGTTGCACGAGTTTTGGGAAGGACAGTAAAGTTTGAAGGAGATGTTGAGAAATGGGAGGAAACATTGAAAAGTGTGCTAAGAATTCCGGTGCAAGAGGAAGATTTTGTTTTATCTATATTAAAATTAAGTGTGGATCGTCTACCATCATCTGCATTAAAGCAATGTTTTTCATATTGTTCAATTTTTCCGAAGGATTTTGTGTTTGAAAAACAAGAACTAATTCAAATGTGGATGGCACAAGGTTTTCTTCAACCACAAGAAGGAAGAAACATGACAATGGAAACTGTAGGAGACATATACTTCAAGATCTTGTTGTCACACTGCTTATTTCAAGATGCCCATGAAACAAGGACAGAAGAATATAAGATGCATGATCTTGTATATGGAACAAGGACAGAAGAATATAAGATGCATGATCTTGTACATGATATTGCAATGGCAATTTCAAGGGATCAAAATTTGCAACTAAATCCTAGCAATATATCGGAGAAGGAACTTCAAAAGAAGGAGATTAAAAATGTTGCATGCAAGCTACGCACGATTGATTTTATTCAAAAGATTCCTCACAATATAGGTCAACTGACATTCTTTGATGTGAAGATAAGAAATTTTGTTTGTTTGCGTATTTTAAAGATATCGAAGATGTCTAGTGAGAAGTTACCGAAGTCAATAGATCAATTGAAACACTTGAGATATCTAGAAATTGCAAGTTATTCAACGAGATTAAAATTTCCAGAGTCTATTGTTTCGCTTCATAATTTGCAAACATTAAAGTTCCTATACTCATTTGTTGAAGAATTTCCAATGAACTTTTCAAATTTGGTAAATTTAAGGCACTTGAAATTATGGCGAAATGTTGACCAAACGCCTCCACATTTAAGTCAATTGACTCAACTTCAAACATTGTCTCATTTTGTAATCGGGTTTGAAGAAGGTTGTAAGATTATTGAATTGGGACCATTGAAAAACTTGCAAGGTAGTTCGAATCTTTTGTGTTTGGAGAAAGTTGAAAGTAAAGAGGAAGCCAAAGGAGCAAACTTGGCAGAAAAGGAGAATTTAAAAGAGCTAAACTTAAGTTGGTCCATGAAAAGAAAAGATAACGACAATTACAATGATTTGGAAGTGTTGGAAGGACTTCAACCAAACCAAAATCTCCAAATATTAAGAATCCACGACTTTACAGAAAGGCGTTTACCTAACAAGATTTTTGTTGAGAATTTAATAGAGATAGGCTTGTATGGTTGTGATAATTGTGAAAAGCTTCCAATGCTTGGACAATTAAACAACTTAAAGAAACTTGAGATTTGCAGCTTCGATGGCGTTCAAATTATAGACAACAAGTTCTATGGTAATGATCCAAACCAAAGAAGGTTCTTCCCAAAGCTTGAGAAATTTGTAATGCAGAATATGATCAACTTAGAGCAATGGGAAGAGGTAATGACAAATGATGCATCATCAAATGTTACAATTTTTCCCAATCTTAAAAGCTTGGAGATAAGTGGATGTCCCAAATTAACAAAAATTCCAAACGGGTTACAATTTTGTAGTTCCATTCGACGTGTGAAAATATACCAATGTTCAAATTTGGGCATAAATATGAGAAATAAGCCGGAATTATGGTATTTACACATTGGTCCGTTAGGCAAGCTACCAGAAGATTTATGTCATCTCATGAATTTGGGGGTAATGACAATTGTTGGAAATATACAGAATTATGATTTTGGCATCCTTCAGCACCTTCCTTCCCTTAAAAAAATTACTTTAGTCGAGGATGAGTTGAGCAATAATAGTGTAACACAAATTCCTCAACAACTTCAACACCTCACTTCCTTGGAATTTCTGTCAATTGAAAATTTTGGAGGCATCGAAGCTTTGCCAGAATGGCTAGGAAACTTGGTATGTTTGCAAACACTCTGTTTTCTTTGTTGCAGAAATTTGAAAAAACTACCTTCTACAGAAGCAATGCTACGTCTCACTAAATTAAATAAATTGTATGCTTGCGAATGTCCAATGCTACTACTCGAAGAAGGTGACCCAGAGCGAGCAAAACTTTCCCACTTTCCAAACGTGTTGGCTCACCGCAACACGTTCGAGAGTTGTAGGTTTTTTTGA


Protein sequences

Name Description Sequence
R-FOM-2 R-FOM-2 [Cucumis melo].

MGDFLWTFAVEEMLKKVLKVAREQTGLAWGFQKHLSKLQKWLLKAEAFLRNINTRKLHHDSVRMWVDDLRHLVYQADDLLDEIVYEDLRQKVQTRKMKKVCDFFSPSTNVLIFRLNMAKKMMTLIALLEKHYLEAAPLGLVGNENVSPEIDVISQYRETISELEDHKILGRDVEVESIVKQVIDASNNQLTSILPIVGMGGLGKTTLAKLVFKHELVRQHFDKTVWVCVSEPFIVNKILLDILQNLKGGISNGGDSKEVLLRELQKEMLGQTYFLVLDDVWNENSFLWGELKYCLLKITGNSKNSIVVTTRSAEVTKIMGTCPGHLLSKLSDDHCWSLFKESANVYGLSMTSNLGIIQKELVKKIGGVPLVARVLGRTVKFEGDVEKWEETLKSVLRIPVQEEDFVLSILKLSVDRLPSSALKQCFSYCSIFPKDFVFEKQELIQMWMAQGFLQPQEGRNMTMETVGDIYFKILLSHCLFQDAHETRTEEYKMHDLVYGTRTEEYKMHDLVHDIAMAISRDQNLQLNPSNISEKELQKKEIKNVACKLRTIDFIQKIPHNIGQLTFFDVKIRNFVCLRILKISKMSSEKLPKSIDQLKHLRYLEIASYSTRLKFPESIVSLHNLQTLKFLYSFVEEFPMNFSNLVNLRHLKLWRNVDQTPPHLSQLTQLQTLSHFVIGFEEGCKIIELGPLKNLQGSSNLLCLEKVESKEEAKGANLAEKENLKELNLSWSMKRKDNDNYNDLEVLEGLQPNQNLQILRIHDFTERRLPNKIFVENLIEIGLYGCDNCEKLPMLGQLNNLKKLEICSFDGVQIIDNKFYGNDPNQRRFFPKLEKFVMQNMINLEQWEEVMTNDASSNVTIFPNLKSLEISGCPKLTKIPNGLQFCSSIRRVKIYQCSNLGINMRNKPELWYLHIGPLGKLPEDLCHLMNLGVMTIVGNIQNYDFGILQHLPSLKKITLVEDELSNNSVTQIPQQLQHLTSLEFLSIENFGGIEALPEWLGNLVCLQTLCFLCCRNLKKLPSTEAMLRLTKLNKLYACECPMLLLEEGDPERAKLSHFPNVLAHRNTFESCRFF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
6-933 PTHR23155:SF121,SUBFAMILY NOT NAMED

WTFAVEEMLKKVLKVAREQTGLAWGFQKHLSKLQKWLLKAEAFLRNINTRKLHHDSVRMWVDDLRHLVYQADDLLDEIVYEDLRQKVQTRKMKKVCDFFSPSTNVLIFRLNMAKKMMTLIALLEKHYLEAAPLGLVGNENVSPEIDVISQYRETISELEDHKILGRDVEVESIVKQVIDASNNQLTSILPIVGMGGLGKTTLAKLVFKHELVRQHFDKTVWVCVSEPFIVNKILLDILQNLKGGISNGGDSKEVLLRELQKEMLGQTYFLVLDDVWNENSFLWGELKYCLLKITGNSKNSIVVTTRSAEVTKIMGTCPGHLLSKLSDDHCWSLFKESANVYGLSMTSNLGIIQKELVKKIGGVPLVARVLGRTVKFEGDVEKWEETLKSVLRIPVQEEDFVLSILKLSVDRLPSSALKQCFSYCSIFPKDFVFEKQELIQMWMAQGFLQPQEGRNMTMETVGDIYFKILLSHCLFQDAHETRTEEYKMHDLVYGTRTEEYKMHDLVHDIAMAISRDQNLQLNPSNISEKELQKKEIKNVACKLRTIDFIQKIPHNIGQLTFFDVKIRNFVCLRILKISKMSSEKLPKSIDQLKHLRYLEIASYSTRLKFPESIVSLHNLQTLKFLYSFVEEFPMNFSNLVNLRHLKLWRNVDQTPPHLSQLTQLQTLSHFVIGFEEGCKIIELGPLKNLQGSSNLLCLEKVESKEEAKGANLAEKENLKELNLSWSMKRKDNDNYNDLEVLEGLQPNQNLQILRIHDFTERRLPNKIFVENLIEIGLYGCDNCEKLPMLGQLNNLKKLEICSFDGVQIIDNKFYGNDPNQRRFFPKLEKFVMQNMINLEQWEEVMTNDASSNVTIFPNLKSLEISGCPKLTKIPNGLQFCSSIRRVKIYQCSNLGINMRNKPELWYLHIGPLGKLPEDLCHLMNLGVM

HMMPanther: PTHR23155
6-933 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

WTFAVEEMLKKVLKVAREQTGLAWGFQKHLSKLQKWLLKAEAFLRNINTRKLHHDSVRMWVDDLRHLVYQADDLLDEIVYEDLRQKVQTRKMKKVCDFFSPSTNVLIFRLNMAKKMMTLIALLEKHYLEAAPLGLVGNENVSPEIDVISQYRETISELEDHKILGRDVEVESIVKQVIDASNNQLTSILPIVGMGGLGKTTLAKLVFKHELVRQHFDKTVWVCVSEPFIVNKILLDILQNLKGGISNGGDSKEVLLRELQKEMLGQTYFLVLDDVWNENSFLWGELKYCLLKITGNSKNSIVVTTRSAEVTKIMGTCPGHLLSKLSDDHCWSLFKESANVYGLSMTSNLGIIQKELVKKIGGVPLVARVLGRTVKFEGDVEKWEETLKSVLRIPVQEEDFVLSILKLSVDRLPSSALKQCFSYCSIFPKDFVFEKQELIQMWMAQGFLQPQEGRNMTMETVGDIYFKILLSHCLFQDAHETRTEEYKMHDLVYGTRTEEYKMHDLVHDIAMAISRDQNLQLNPSNISEKELQKKEIKNVACKLRTIDFIQKIPHNIGQLTFFDVKIRNFVCLRILKISKMSSEKLPKSIDQLKHLRYLEIASYSTRLKFPESIVSLHNLQTLKFLYSFVEEFPMNFSNLVNLRHLKLWRNVDQTPPHLSQLTQLQTLSHFVIGFEEGCKIIELGPLKNLQGSSNLLCLEKVESKEEAKGANLAEKENLKELNLSWSMKRKDNDNYNDLEVLEGLQPNQNLQILRIHDFTERRLPNKIFVENLIEIGLYGCDNCEKLPMLGQLNNLKKLEICSFDGVQIIDNKFYGNDPNQRRFFPKLEKFVMQNMINLEQWEEVMTNDASSNVTIFPNLKSLEISGCPKLTKIPNGLQFCSSIRRVKIYQCSNLGINMRNKPELWYLHIGPLGKLPEDLCHLMNLGVM

superfamily: SSF52540
151-402 SSF52540

DVISQYRETISELEDHKILGRDVEVESIVKQVIDASNNQLTSILPIVGMGGLGKTTLAKLVFKHELVRQHFDKTVWVCVSEPFIVNKILLDILQNLKGGISNGGDSKEVLLRELQKEMLGQTYFLVLDDVWNENSFLWGELKYCLLKITGNSKNSIVVTTRSAEVTKIMGTCPGHLLSKLSDDHCWSLFKESANVYGLSMTSNLGIIQKELVKKIGGVPLVARVLGRTVKFEGDVEKWEETLKSVLRIPVQE

HMMPfam: PF00931
IPR002182
174-456 NB-ARC,NBS
NB-ARC

EVESIVKQVIDASNNQLTSILPIVGMGGLGKTTLAKLVFKHELVRQHFDKTVWVCVSEPFIVNKILLDILQNLKGGISNGGDSKEVLLRELQKEMLGQTYFLVLDDVWNENSFLWGELKYCLLKITGNSKNSIVVTTRSAEVTKIMGTCPGHLLSKLSDDHCWSLFKESANVYGLSMTSNLGIIQKELVKKIGGVPLVARVLGRTVKFEGDVEKWEETLKSVLRIPVQEEDFVLSILKLSVDRLPSSALKQCFSYCSIFPKDFVFEKQELIQMWMAQGFLQPQ

Gene3D: G3DSA:3.40.50.300
177-315 G3DSA:3.40.50.300

SIVKQVIDASNNQLTSILPIVGMGGLGKTTLAKLVFKHELVRQHFDKTVWVCVSEPFIVNKILLDILQNLKGGISNGGDSKEVLLRELQKEMLGQTYFLVLDDVWNENSFLWGELKYCLLKITGNSKNSIVVTTRSAEV

FPrintScan: PR00364
IPR000767
193-208 DISEASERSIST
Disease resistance protein

ILPIVGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
267-281 DISEASERSIST
Disease resistance protein

EMLGQTYFLVLDDVW

FPrintScan: PR00364
IPR000767
365-379 DISEASERSIST
Disease resistance protein

IGGVPLVARVLGRTV

superfamily: SSF52058
506-902 SSF52058,LRR

KMHDLVHDIAMAISRDQNLQLNPSNISEKELQKKEIKNVACKLRTIDFIQKIPHNIGQLTFFDVKIRNFVCLRILKISKMSSEKLPKSIDQLKHLRYLEIASYSTRLKFPESIVSLHNLQTLKFLYSFVEEFPMNFSNLVNLRHLKLWRNVDQTPPHLSQLTQLQTLSHFVIGFEEGCKIIELGPLKNLQGSSNLLCLEKVESKEEAKGANLAEKENLKELNLSWSMKRKDNDNYNDLEVLEGLQPNQNLQILRIHDFTERRLPNKIFVENLIEIGLYGCDNCEKLPMLGQLNNLKKLEICSFDGVQIIDNKFYGNDPNQRRFFPKLEKFVMQNMINLEQWEEVMTNDASSNVTIFPNLKSLEISGCPKLTKIPNGLQFCSSIRRVKIYQCSNLGIN

Gene3D: G3DSA:3.80.10.10
535-729 G3DSA:3.80.10.10

ELQKKEIKNVACKLRTIDFIQKIPHNIGQLTFFDVKIRNFVCLRILKISKMSSEKLPKSIDQLKHLRYLEIASYSTRLKFPESIVSLHNLQTLKFLYSFVEEFPMNFSNLVNLRHLKLWRNVDQTPPHLSQLTQLQTLSHFVIGFEEGCKIIELGPLKNLQGSSNLLCLEKVESKEEAKGANLAEKENLKELNLS

superfamily: SSF52047
809-1042 SSF52047,LRR

DGVQIIDNKFYGNDPNQRRFFPKLEKFVMQNMINLEQWEEVMTNDASSNVTIFPNLKSLEISGCPKLTKIPNGLQFCSSIRRVKIYQCSNLGINMRNKPELWYLHIGPLGKLPEDLCHLMNLGVMTIVGNIQNYDFGILQHLPSLKKITLVEDELSNNSVTQIPQQLQHLTSLEFLSIENFGGIEALPEWLGNLVCLQTLCFLCCRNLKKLPSTEAMLRLTKLNKLYACECPML

Gene3D: G3DSA:3.80.10.10
856-1041 G3DSA:3.80.10.10

SNVTIFPNLKSLEISGCPKLTKIPNGLQFCSSIRRVKIYQCSNLGINMRNKPELWYLHIGPLGKLPEDLCHLMNLGVMTIVGNIQNYDFGILQHLPSLKKITLVEDELSNNSVTQIPQQLQHLTSLEFLSIENFGGIEALPEWLGNLVCLQTLCFLCCRNLKKLPSTEAMLRLTKLNKLYACECPM

FPrintScan: PR00364
IPR000767
859-875 DISEASERSIST
Disease resistance protein

TIFPNLKSLEISGCPKL


Diseases

Disease Pathogen Avirulence gene
Fusarium Wilt Fusarium oxysporum

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox