PRGDB00061466 (RLM3)

From PRG Wiki
Revision as of 22:32, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
RLM3
Gene Type Reference_R-Genes,_manually_curated
GenBank 79325134 (NM_001036575)
Gene Class TN
Domain Type NBS, TIR, Others
Chromosome 4
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana RLM3 (RESISTANCE TO LEPTOSPHAERIA MACULANS 3); ATP binding (RLM3) mRNA, complete cds.

DNA Sequence

ATGCTTGAAAATATCGCCAAGGATGTTTCAAACAAACTCTTCCCCCCATCAAATAATTTCAGTGACTTCGTCGGGATTGAAGCTCATATAGAGGCATTGATATCAATGTTGCGCTTCGACTCCAAGAAAGCGCGAATGATAGGGATTTGTGGGCCTTCTGAAACTGGTAAGACTACTATAGGAAGAGCTTTATACAGCAGACTCAAAAGCGACTTCCACCATCGGGCTTTCGTAGCATATAAGAGAAAAATACGGAGCGACTATGACCAGAAGCTGTATTGGGAAGAACAATTTCTATCAGAAATTCTTTGTCAGAAGGATATAAAGATAGAGGAATGTGGTGCGGTGGAACAACGACTAAAGCACACGAAAGTTCTTATTGTTCTTGATGATGTTGATGATATAGAGCTACTAAAAACGTTGGTAGGACGTATCAGATGGTTTGGATCTGAGAGCAAAATTGTTGTGATTACTCAAAAAAGGGAACTTCTCAAGGCTCACAACATTGCACATGTTTATGAAGTGGGATTCCCATCAGAAGAACTGGCTCATCAAATGTTTTGTCGATATGCTTTTGGGAAAAACTCTCCACCTCATGGTTTCAACGAGCTTGCAGATGAAGCTGCAAAGATTGCCGGTAATCGTCCTAAAGCTCTCAAGTACGTTGGTTCGTCTTTTAGAAGACTAGACAAGGAACAATGGGTGAAGATGCTATCGGAGTTCCGTAGTAATGGGAATAAACTAAAAATCAGCTATGATGAGTTAGATGGTAAAGGTCAAGATTACGTTGCGTGTTTAACCAATGGTTCAAATTCCCAGGTGAAGGCAGAGTGGATCCACTTGGCACTAGGCGTGTCTATATTACTTAACATCCGCAGTGACGGAACGACAATTCTCAAACATTTGAGCTACAATCGAAGCATGGCGCAACAAGCAAAAATATGGTGGTATGAAAATTTGGAAAGAGTGTGCAAGAAGTACAATATATGTGGCATAGATAGCTCAACTGATGGTGGTGGTTCAACGTATGGACAATGTTCAAATTCCCAATTTCAAAGAAACATGGACGCAAGCCCCGGGGGAAACAAAACCAGTAATCAATCCACAAAAGATTCACCGAGAGCTTCTCAAGTAGAGAAGGAAAAGATCGAGTACTGTGAGCCACATGTATATATAACACCTGCCATCTTCAGTGACGGAACCAGAGCTCCCAAATACGTGGAGTCTAGTAGCCGAAGAGTAACCCAAGTGCACCACGCCAAAACATGGTGGCCGGAGAATTGTGAAAAAGTGTACGAGAACCACAACAACATATATGGCATAGATAGATCAATTGACGGTGGTGATAAGTTTGAGGGAAAAAGTAAAGTTAGTGACGGTGGGTTAGACGGCAAAGATCAAGGTTCAATGTATGGACAAAGTTCAAATTCCGAGCTTCAAATAAACATGGACGCAGACAATAGGAGATGTGAACCTGTGAGTGAGATGCTTTTCAAAAATTACAATGTGTGTTCGCCTAATGCACATATGCCTGCAGGTTTAACCGATGTAAACTGTTCAAATCCCCAGTCTCAAAGAAAATTGGACGCAAGCCTAAAGAAAGACAAAATTGTGCATGAGTGGATTCGAACCGGTAGTGGCTTCTTTTTTGATTTTCAGGGCCCAAAATCTATAGTGAGTGCTGCTCAAGTGGACGAGAAAAATTTCGAGTACTGTGAACAAGGTGTGTATATAACACTTGGCATCCTCAGTGGCGGAATTATAGTTCTCAAACATTTGGAGTTCAGCCGAAGAATGGCGCAACAAGCAAAAGTTTGGTGGTCGGAAAATTGGATAAAAGTGTACCAGGAGCACAACATATGTGGCATAGATAAATCATTTGATGGTAGGTTTGATGATAGACGTGTCATTCGTCAATTAAGACCAAACTGA


Protein sequences

Name Description Sequence
RLM3 (RESISTANCE TO LEPTOSPHAERIA MACULANS 3); ATP binding RLM3 (RESISTANCE TO LEPTOSPHAERIA MACULANS 3); ATP binding [Arabidopsis thaliana].

MLENIAKDVSNKLFPPSNNFSDFVGIEAHIEALISMLRFDSKKARMIGICGPSETGKTTIGRALYSRLKSDFHHRAFVAYKRKIRSDYDQKLYWEEQFLSEILCQKDIKIEECGAVEQRLKHTKVLIVLDDVDDIELLKTLVGRIRWFGSESKIVVITQKRELLKAHNIAHVYEVGFPSEELAHQMFCRYAFGKNSPPHGFNELADEAAKIAGNRPKALKYVGSSFRRLDKEQWVKMLSEFRSNGNKLKISYDELDGKGQDYVACLTNGSNSQVKAEWIHLALGVSILLNIRSDGTTILKHLSYNRSMAQQAKIWWYENLERVCKKYNICGIDSSTDGGGSTYGQCSNSQFQRNMDASPGGNKTSNQSTKDSPRASQVEKEKIEYCEPHVYITPAIFSDGTRAPKYVESSSRRVTQVHHAKTWWPENCEKVYENHNNIYGIDRSIDGGDKFEGKSKVSDGGLDGKDQGSMYGQSSNSELQINMDADNRRCEPVSEMLFKNYNVCSPNAHMPAGLTDVNCSNPQSQRKLDASLKKDKIVHEWIRTGSGFFFDFQGPKSIVSAAQVDEKNFEYCEQGVYITLGILSGGIIVLKHLEFSRRMAQQAKVWWSENWIKVYQEHNICGIDKSFDGRFDDRRVIRQLRPN

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
6-240 SSF52540

AKDVSNKLFPPSNNFSDFVGIEAHIEALISMLRFDSKKARMIGICGPSETGKTTIGRALYSRLKSDFHHRAFVAYKRKIRSDYDQKLYWEEQFLSEILCQKDIKIEECGAVEQRLKHTKVLIVLDDVDDIELLKTLVGRIRWFGSESKIVVITQKRELLKAHNIAHVYEVGFPSEELAHQMFCRYAFGKNSPPHGFNELADEAAKIAGNRPKALKYVGSSFRRLDKEQWVKMLSE

Gene3D: G3DSA:3.40.50.300
15-166 G3DSA:3.40.50.300

PPSNNFSDFVGIEAHIEALISMLRFDSKKARMIGICGPSETGKTTIGRALYSRLKSDFHHRAFVAYKRKIRSDYDQKLYWEEQFLSEILCQKDIKIEECGAVEQRLKHTKVLIVLDDVDDIELLKTLVGRIRWFGSESKIVVITQKRELLKA

HMMPfam: PF00931
IPR002182
27-255 NB-ARC,NBS
NB-ARC

EAHIEALISMLRFDSKKARMIGICGPSETGKTTIGRALYSRLKSDFHHRAFVAYKRKIRSDYDQKLYWEEQFLSEILCQKDIKIEECGAVEQRLKHTKVLIVLDDVDDIELLKTLVGRIRWFGSESKIVVITQKRELLKAHNIAHVYEVGFPSEELAHQMFCRYAFGKNSPPHGFNELADEAAKIAGNRPKALKYVGSSFRRLDKEQWVKMLSEFRSNGNKLKISYDEL

FPrintScan: PR00364
IPR000767
46-61 DISEASERSIST
Disease resistance protein

MIGICGPSETGKTTIG

FPrintScan: PR00364
IPR000767
119-133 DISEASERSIST
Disease resistance protein

RLKHTKVLIVLDDVD

FPrintScan: PR00364
IPR000767
212-226 DISEASERSIST
Disease resistance protein

AGNRPKALKYVGSSF

HMMPfam: PF08381
IPR013591
273-328 BRX
Brevis radix-like domain

QVKAEWIHLALGVSILLNIRSDGTTILKHLSYNRSMAQQAKIWWYENLERVCKKYN

ProfileScan: PS51514
IPR013591
276-328 BRX
Brevis radix-like domain

AEWIHLALGVSILLNIRSDGTTILKHLSYNRSMAQQAKIWWYENLERVCKKYN

HMMPfam: PF08381
IPR013591
377-436 BRX
Brevis radix-like domain

QVEKEKIEYCEPHVYITPAIFSDGTRAPKYVESSSRRVTQVHHAKTWWPENCEKVYENHN

HMMPanther: PTHR22870:SF61
378-643 PTHR22870:SF61,DISEASE RESISTANCE PROTEIN (TIR-NBS CLASS)

VEKEKIEYCEPHVYITPAIFSDGTRAPKYVESSSRRVTQVHHAKTWWPENCEKVYENHNNIYGIDRSIDGGDKFEGKSKVSDGGLDGKDQGSMYGQSSNSELQINMDADNRRCEPVSEMLFKNYNVCSPNAHMPAGLTDVNCSNPQSQRKLDASLKKDKIVHEWIRTGSGFFFDFQGPKSIVSAAQVDEKNFEYCEQGVYITLGILSGGIIVLKHLEFSRRMAQQAKVWWSENWIKVYQEHNICGIDKSFDGRFDDRRVIRQLRPN

HMMPanther: PTHR22870
378-643 PTHR22870,REGULATOR OF CHROMOSOME CONDENSATION

VEKEKIEYCEPHVYITPAIFSDGTRAPKYVESSSRRVTQVHHAKTWWPENCEKVYENHNNIYGIDRSIDGGDKFEGKSKVSDGGLDGKDQGSMYGQSSNSELQINMDADNRRCEPVSEMLFKNYNVCSPNAHMPAGLTDVNCSNPQSQRKLDASLKKDKIVHEWIRTGSGFFFDFQGPKSIVSAAQVDEKNFEYCEQGVYITLGILSGGIIVLKHLEFSRRMAQQAKVWWSENWIKVYQEHNICGIDKSFDGRFDDRRVIRQLRPN

ProfileScan: PS51514
IPR013591
380-436 BRX
Brevis radix-like domain

KEKIEYCEPHVYITPAIFSDGTRAPKYVESSSRRVTQVHHAKTWWPENCEKVYENHN

HMMPfam: PF08381
IPR013591
564-619 BRX
Brevis radix-like domain

VDEKNFEYCEQGVYITLGILSGGIIVLKHLEFSRRMAQQAKVWWSENWIKVYQEHN

ProfileScan: PS51514
IPR013591
566-619 BRX
Brevis radix-like domain

EKNFEYCEQGVYITLGILSGGIIVLKHLEFSRRMAQQAKVWWSENWIKVYQEHN


Diseases

Disease Pathogen Avirulence gene
Black leg (stem canker) Leptosphaeria maculans




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox