PRGDB00061468 (Lr21)

From PRG Wiki
Revision as of 22:32, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Lr21
Gene Type Reference_R-Genes,_manually_curated
GenBank 226424825 (FJ876280)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Triticum aestivum

Comment?

Triticum aestivum Lr21 gene, complete cds.

DNA Sequence

ATGGCTACTGCTTGGGACGTTGCCTCTGTTGGTTGGTCCATGGTCGTGTTGGGCTGGTTGGTGTCGCCTGTCATCACCTTGATCCTGCCCAAGATCCTTTCCCGCCTGGGTTTCGATGCGGCACAGAAGCTCCAGGGGCTAGTGATCAGCATCATGCCCGAGATGGAGAACACGCTGCGGGCCGTAGATCAGGAGAGGATGATGCTGAGAGGAAAGAAATCAAACTCCGATGTGGCCGCACTGGACAAGATGGCCGCCATGCTGAGGCACGCTCGGGAGGATGCAGAGGACATCTTCGATGATGCTCATGAGAAGATCTGCGTCGGAGACTTCCTCTACGGCGTCGTGCAATCCTTCCTCGACGGGATTGCACGCATCATTCGGAGCAGATGGGCTTGGCTAATGCAGTGGGCACGGAGGAGCTCTTTGTGTCGTTTCCTTGAGCACGCTTCCGGTGAGGCCGTCACTATCGGTGTTGCCGCCTCAAATGAGCCCGGTCATGTGACTATAAATGTTGCGGCGCCCTCTGGCGGCGAGTCTATTCCGGTAACTACCAGTGCTGCAGCCTCACACGAACCAACAGCTCCATCCTCCGATTCCTTGGGGCGGTGTCTCTCTTGCTTTTCCAGCTCCTTCAACTTCGTCAAGTACTATTGTACATCCAGCTTCAACTGGTTACGCTTTTACCGAGATTGGTCCTATGAGGTGGTTGGTGTCACAACTTATCAGGAGAATGCCACTGCATTGGATGTTGTCCTTACTGCTATCTCAAGATGGAACTTGAATAAAAGAATAGAGAAGGTACAAAGTACCATCAGCGAAGTGACGAAGTCACCGCTCTTGGGCACGGCAAGCAAGAGTGCACCAGACGATATTGCTAACAAGAATAGGAGTAGAATTAGAACTGCTAGCAAGCGGAAGGTATTTGGTCGAGAGGGGCTGCGTGATCATATCATGGTAAGGCTTCGTGAGATACCAGAGCATGATGCAGCAAGCTCAAGTGCTGATCCATGTTACTCAGTGATTGGTATATATGGTGTTGCTGGGTCTGGGAAGACCACGTTTGCAGGATATATTCAAGATTACATAAAGGAGGAATGCAAGGATGAGAAACTTTTCGACACCATCATGTGCATTCATGTGACTGAAACTTTCAGTGTGGATGATATATTTCATGAAATGCTGAAGTATATTACCGGAGATAGTCACTCCAATATTTCAGATCGTGGGGCTCTAGATAAGAAGTTGAAGGAAGCATTGTGTGGCAAACGTTTCTTCTTGATATTGGATGATCTCTGGGTGAAAAACAAGAATGACCAACACCTAGAGGAGCTAATCTCTCCACTCAATGTTGGGCTGAAAGGAAGCAAAATCCTGGTGACGGCTCGAACAAAAGAAGCAGCTGGAGCTCTGGGTGCCGATAAATTTATTGAAATGCCTGATTTGGATGAGGATCAGTACTTGGCGATGTTTATGCATTATGCGCTAAGTGATACAAGAGTTGCCCTTCAAGAATTTGAACAAGTTGGGAGAGAGATTGCCAAAAAACTACACCGATCACCTATTGCAGCAGTAACAGTTGCAGGACGGCTTGGGGCAAACCCAAATATCAGTTTTTGGAAAAATGTTGCAAAGCTTGACATGTTGAATTACACCATGGATGCTCTTTGGTGGAGCTATCAGCAGCTTGATCCGGACATTAGGCGATGCTTTGAATTCTGCAGTATTTTCCCCAGAAAATTCAAACTGGAAAAAGACCAATTAGTCCGCCTGTGGACAGCACAAGGATTTGTAAAGACCAGTTGTGCAACGGAGGAGATGGAAGATGTTGCCGAGGGCTACATTCAAGAGTTAGTGTCATGCTCATTTCTGCAAGAAAAAGGAACTGGTTCTGGCGTTGATCATTTTACAATTCATGATCTGTTGCATGATTTATTAGTCAAGGTTGCTGGAAATGATTGCTTCAGAATCGAGAATAGATGGAGTAAACAAGGAGAATGCCAAGAAGATGTCCCTCGAGATGTCCGTCATCTTTTTGTTCAGAAGTATGATGGGGAATTGATTACCAGGAAGATCCTTGGATTGGAAAATTTACGCACTCTCATTATTTGTGTTGTCGAAGAGAATAGACCAGTTGAGGAAAAGGTCATTGAGAGTATGTGCGTGAGGCTGCTGAAGTTGCGGGTACTGGCCATTGCTTTCAACAAAAAATGCCGTTCAACCAGCAATCCCAGTGATAAGTTCTTGGTCCCAGAATCCATTACTCAGTTAAAGCACCTCCGCTATCTAGCTTTCCGGAAAAGTGACAACTGCAAGGTTATTTTGCCAAGTGCACTAGCTAAACTTCTCCATATCCAGCTGCTAGATTTTGGTCTTGGCAAAATTTCGGATTTTACCTGTGCTGCTGACCTTATCAACTTGCGGCACATATTCTGCTGGGATGTGAGCTTTCCTAACATAGGCACGCTGAGCTCACTTCAAAGAATACCCTTCTTCAGGCTAAGGAATGAACAGGGTTATGAGATAAAACAACTTAGGGACCTGAACAAGATTCGTGGCATGCTGGTGGTCAATGGCTTTGAAAATGTTAAAAGCAAGGAGGAAGCTCTTGAAGCCAATCTAGCTGCCAAGGAAAGGCTCACGGAACTGATACTATGTTTTTTGACTTCCCATACACGGGGCAATGGCAATGCGGAAGTTGCAGCAGAGGTGCTTGAGGGCCTGTGCCCTCCCGTGGGGCTAGAAGCACTGCTCATCTATGACTACAACGGCTCAAGGTACCCAGATTGGATGGTGGGTAAGCTGACCGGTGGCCCAAAGAACCTGAAACTACTTGAAATCTATGGCTGCAGCCGACTGGGACCTGGCCCTCAACTTGAGGCTTTCCCTCATCTTCGTATGCTCAACCTTGAGGACTGCAGCTGGGACGCCTTACCAGGCAACTTGGAGCACCTCACTTCGCTCAAGGCACTGAAGATCGAGCATTGCATGAATATCCGGTCGCTTCCAACACTGCCCCAGTCTCTGAAGCTGTTCATACTTCGGTGCTGCGATGTTGAGCTCATGAAGAGTTGTGAAACAGAAGGAGATCCAAACTGGCATAAGATAAAGCACATCCCCGATAAAATGGTTTCAGGCCAACCTCACAGCATCTACCACATCAGGAGAATGTTCCGAGTGTCGGCCCCAGTCCCGACGCTGAGTACTTCCGGTGACGGCGACACGACCGACGAACGAAGATGA


Protein sequences

Name Description Sequence
Lr21 Lr21 [Triticum aestivum].

MATAWDVASVGWSMVVLGWLVSPVITLILPKILSRLGFDAAQKLQGLVISIMPEMENTLRAVDQERMMLRGKKSNSDVAALDKMAAMLRHAREDAEDIFDDAHEKICVGDFLYGVVQSFLDGIARIIRSRWAWLMQWARRSSLCRFLEHASGEAVTIGVAASNEPGHVTINVAAPSGGESIPVTTSAAASHEPTAPSSDSLGRCLSCFSSSFNFVKYYCTSSFNWLRFYRDWSYEVVGVTTYQENATALDVVLTAISRWNLNKRIEKVQSTISEVTKSPLLGTASKSAPDDIANKNRSRIRTASKRKVFGREGLRDHIMVRLREIPEHDAASSSADPCYSVIGIYGVAGSGKTTFAGYIQDYIKEECKDEKLFDTIMCIHVTETFSVDDIFHEMLKYITGDSHSNISDRGALDKKLKEALCGKRFFLILDDLWVKNKNDQHLEELISPLNVGLKGSKILVTARTKEAAGALGADKFIEMPDLDEDQYLAMFMHYALSDTRVALQEFEQVGREIAKKLHRSPIAAVTVAGRLGANPNISFWKNVAKLDMLNYTMDALWWSYQQLDPDIRRCFEFCSIFPRKFKLEKDQLVRLWTAQGFVKTSCATEEMEDVAEGYIQELVSCSFLQEKGTGSGVDHFTIHDLLHDLLVKVAGNDCFRIENRWSKQGECQEDVPRDVRHLFVQKYDGELITRKILGLENLRTLIICVVEENRPVEEKVIESMCVRLLKLRVLAIAFNKKCRSTSNPSDKFLVPESITQLKHLRYLAFRKSDNCKVILPSALAKLLHIQLLDFGLGKISDFTCAADLINLRHIFCWDVSFPNIGTLSSLQRIPFFRLRNEQGYEIKQLRDLNKIRGMLVVNGFENVKSKEEALEANLAAKERLTELILCFLTSHTRGNGNAEVAAEVLEGLCPPVGLEALLIYDYNGSRYPDWMVGKLTGGPKNLKLLEIYGCSRLGPGPQLEAFPHLRMLNLEDCSWDALPGNLEHLTSLKALKIEHCMNIRSLPTLPQSLKLFILRCCDVELMKSCETEGDPNWHKIKHIPDKMVSGQPHSIYHIRRMFRVSAPVPTLSTSGDGDTTDERR

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
306-528 SSF52540

RKVFGREGLRDHIMVRLREIPEHDAASSSADPCYSVIGIYGVAGSGKTTFAGYIQDYIKEECKDEKLFDTIMCIHVTETFSVDDIFHEMLKYITGDSHSNISDRGALDKKLKEALCGKRFFLILDDLWVKNKNDQHLEELISPLNVGLKGSKILVTARTKEAAGALGADKFIEMPDLDEDQYLAMFMHYALSDTRVALQEFEQVGREIAKKLHRSPIAAVTVA

HMMPfam: PF00931
IPR002182
339-601 NB-ARC,NBS
NB-ARC

YSVIGIYGVAGSGKTTFAGYIQDYIKEECKDEKLFDTIMCIHVTETFSVDDIFHEMLKYITGDSHSNISDRGALDKKLKEALCGKRFFLILDDLWVKNKNDQHLEELISPLNVGLKGSKILVTARTKEAAGALGADKFIEMPDLDEDQYLAMFMHYALSDTRVALQEFEQVGREIAKKLHRSPIAAVTVAGRLGANPNISFWKNVAKLDMLNYTMDALWWSYQQLDPDIRRCFEFCSIFPRKFKLEKDQLVRLWTAQGFVKTS

Gene3D: G3DSA:3.40.50.300
341-410 G3DSA:3.40.50.300

VIGIYGVAGSGKTTFAGYIQDYIKEECKDEKLFDTIMCIHVTETFSVDDIFHEMLKYITGDSHSNISDRG

FPrintScan: PR00364
IPR000767
341-356 DISEASERSIST
Disease resistance protein

VIGIYGVAGSGKTTFA

FPrintScan: PR00364
IPR000767
419-433 DISEASERSIST
Disease resistance protein

ALCGKRFFLILDDLW

superfamily: SSF52058
637-1061 SSF52058,LRR

TIHDLLHDLLVKVAGNDCFRIENRWSKQGECQEDVPRDVRHLFVQKYDGELITRKILGLENLRTLIICVVEENRPVEEKVIESMCVRLLKLRVLAIAFNKKCRSTSNPSDKFLVPESITQLKHLRYLAFRKSDNCKVILPSALAKLLHIQLLDFGLGKISDFTCAADLINLRHIFCWDVSFPNIGTLSSLQRIPFFRLRNEQGYEIKQLRDLNKIRGMLVVNGFENVKSKEEALEANLAAKERLTELILCFLTSHTRGNGNAEVAAEVLEGLCPPVGLEALLIYDYNGSRYPDWMVGKLTGGPKNLKLLEIYGCSRLGPGPQLEAFPHLRMLNLEDCSWDALPGNLEHLTSLKALKIEHCMNIRSLPTLPQSLKLFILRCCDVELMKSCETEGDPNWHKIKHIPDKMVSGQPHSIYHIRRMFRVS

HMMPanther: PTHR23155
673-1065 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RDVRHLFVQKYDGELITRKILGLENLRTLIICVVEENRPVEEKVIESMCVRLLKLRVLAIAFNKKCRSTSNPSDKFLVPESITQLKHLRYLAFRKSDNCKVILPSALAKLLHIQLLDFGLGKISDFTCAADLINLRHIFCWDVSFPNIGTLSSLQRIPFFRLRNEQGYEIKQLRDLNKIRGMLVVNGFENVKSKEEALEANLAAKERLTELILCFLTSHTRGNGNAEVAAEVLEGLCPPVGLEALLIYDYNGSRYPDWMVGKLTGGPKNLKLLEIYGCSRLGPGPQLEAFPHLRMLNLEDCSWDALPGNLEHLTSLKALKIEHCMNIRSLPTLPQSLKLFILRCCDVELMKSCETEGDPNWHKIKHIPDKMVSGQPHSIYHIRRMFRVSAPVP

HMMPanther: PTHR23155:SF143
673-1065 PTHR23155:SF143,OS04G0325300 PROTEIN (FRAGMENT)

RDVRHLFVQKYDGELITRKILGLENLRTLIICVVEENRPVEEKVIESMCVRLLKLRVLAIAFNKKCRSTSNPSDKFLVPESITQLKHLRYLAFRKSDNCKVILPSALAKLLHIQLLDFGLGKISDFTCAADLINLRHIFCWDVSFPNIGTLSSLQRIPFFRLRNEQGYEIKQLRDLNKIRGMLVVNGFENVKSKEEALEANLAAKERLTELILCFLTSHTRGNGNAEVAAEVLEGLCPPVGLEALLIYDYNGSRYPDWMVGKLTGGPKNLKLLEIYGCSRLGPGPQLEAFPHLRMLNLEDCSWDALPGNLEHLTSLKALKIEHCMNIRSLPTLPQSLKLFILRCCDVELMKSCETEGDPNWHKIKHIPDKMVSGQPHSIYHIRRMFRVSAPVP

Gene3D: G3DSA:3.80.10.10
688-834 G3DSA:3.80.10.10

ITRKILGLENLRTLIICVVEENRPVEEKVIESMCVRLLKLRVLAIAFNKKCRSTSNPSDKFLVPESITQLKHLRYLAFRKSDNCKVILPSALAKLLHIQLLDFGLGKISDFTCAADLINLRHIFCWDVSFPNIGTLSSLQRIPFFRL

Gene3D: G3DSA:3.80.10.10
937-1015 G3DSA:3.80.10.10

GGPKNLKLLEIYGCSRLGPGPQLEAFPHLRMLNLEDCSWDALPGNLEHLTSLKALKIEHCMNIRSLPTLPQSLKLFILR

FPrintScan: PR00364
IPR000767
983-999 DISEASERSIST
Disease resistance protein

EHLTSLKALKIEHCMNI


Diseases

Disease Pathogen Avirulence gene
Wheat leaf rust Puccinia triticina

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox