PRGDB00061469 (Lr1)

From PRG Wiki
Revision as of 22:32, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Lr1
Gene Type Reference_R-Genes,_manually_curated
GenBank 152060785 (EF439840)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Triticum aestivum

Comment?

Triticum aestivum Lr1 disease resistance protein (Lr1) gene, complete cds.

DNA Sequence

ATGGCGGCGGCTCTCGGCTCGGCGGCCACGCTCCTCGGCAAGGTGTTCACTATGCTGTCCGCCGCCCCGGTGGCGGCGTACGTGGACAGCCTGGAGCTCGGCCACAACTCCCAGCAGATCAGGGCCAAGCTCGCGCACACGCGAGGCCTGCTGCACAACGCCCAAGCCCAGGTGAGCGACGTCGGCCACAACCCTGGACTGCAGGAGCTGCTGCCGGCGCTGAGCAGGAACGCCGACGAGGCGGAGGATCTGCTGGATGAGCTCCACTACTTCCAGATCCATGACAGGCTCCACGCCACCAACTACGCCGCCACCCAGGCCAATTTTCTCCGTCATGCTCGCAATGCTCTCCGCCACACTGCCACCAGCAGCTGGGCCGCATGCTTTTCTTGTTCCTCTGCACAAGATGATAGTGATTCTACCAGTGGGGATGATGAGTTACGTTTCCACCGAGTGATCTTCTCCAGAAAATTCAAGTCGGTGTTACAGGACATGCAGACGCACTGTGATTCCGTCTCTGATTTGCTCGGCACTATCCCAACCAGCAGCATGCCAGTTGCTGTACACCGGCCGCAGATTGGATCCACAATTATACAAGATACATTGTATGGCAGGAGACACACTTTTGAGGAAACTGTCAACCGTATCTTCAGCTGCAAACACCCTGTTTCTGTTCTTCCTATAGTTGGTCCAGGGGGTATTGGAAAGACAACTTTTGCTCAACATCTGTATAATGATGCAAGGACTGAAGAGCACTTCCAAGTCAGGGTCTGGGTGTGTGTATCCACTGATTTCAATGTGCTTAAGCTCACCAGGGAGATCCTTGCCTGCATACCTGCAACTGAAGAAGGAGGAAGCAGCAGTGTTGCAAATGAAACAACCAATTTAGATCATCTTCAGAGATCCATTGTGCGCCGTCTCAAGTCCAAGAGGTTTCTAATTGTCTTGGACGATATATGGAAATGTGACAGTCAGGATCAGTGGAAAACCTTGTTAGCTCCCTTCACAAAGGGGGAAACCAAAGGAAGCATGCTACTTGTCACAACTCGATTTCCAAAGCTAGCACAAATGATGGAAACAATTGATCCACTAGAGCTGCTAGGTTTGGAGTCTAATGACTTCTTCACATTCTTTGAAGCATGTATATTTGGTGAAGACAACAAGCCAGAGCATTTCGAAGATGAGTTAGCTGGTATTGCACAAAAAATTGCAGACAAGCTAAAGGGTTCCCCGCTGGCAGCCAAAACAGTTGGTAGACTATTGCACAAGGACCTTTCTCAGAAACATTGGAATGGAGTTCTTGAAAAGCATCAGTGGCTAAAGCAGCAAAATAATGATGATATCATGCCATCTTTAAAAATTAGCTATGATTGCCTCCCTTTTGATCTGAAGAAATGTTTTTCCTATTGTGGCCTTTTCCCCGAAGATCATTGGTTTACTTCTTCAGAAATCAATCATTTCTGGGTTGCAGTAGGCATCATAGACTCTGATCACCAAGCCGATAGGAATTACCTGGAAGAGCTAGTGGACAATGGTTTTCTCATGAAGAAGAAAGAGTATTATTTGGATGATCGATGCAAACAAAAGGAATTTGATTGCTATGTAATGCATGATTTAATGCATGAGCTATCTAAGAGTGTTTCTGCACAAGAATGCCTCAATATAAGTGGCTTTGATTTCAGAGCTGATGCCATCCCGCAATCTGTTCGACACTTATCTATCAACATAGAAGACAGATATGATGCAAATTTTGAGGAAGAAATGTCTAAACTAAGGGAGAAGATAGACATTGCTAATGTGCGGACTTTGATGATTTTTAGAGAATATGAAGAAGAAAGAACCGCCAAGATATTGAAAGATAGCTTCAAGGAAATAAATAGTCTGCGTGTCCTATTTATAGTGGTGAAGTCTGCACAATCTTTTCCGGATATGTTTTCAAAACTTATCCACCTCCAGTACCTCAAAATTAGTTCACCTCACATTGACGGGGAAATGAGGTTACCTAGTACACTATCAAGATTTTATCACTTGAAATTCCTGGACCTAGATGATTGGCGTGGTAGTTCTGATTTGCCTGAAGACTTTAGCCACCTTGAGAATTTACATGATTTCCGTGCTGAAAGTAAACTCCACTCCAATATTCGCAATGTTGGAAAGATGAAGCATCTACAGAGGCTAGAAGAATTCCATGTTAAGAAGGAGAGCATGGGATTTGAACTGTCAGAACTTGGGCCATTGACAGAGCTTGAAGGAGGACTGACTGTACGTGGTCTTGAACACGTGGCAACCAAGGAGGAAGCTACTGCAGCCAAACTGATGTTGAAAAGGAATCTGAAGCAGTTGGAATTACTCTGGGACAGAGACCTTGGTGGACCAACTACAGATGCTGATATTCTTGATGCTCTTCAACCACACTCTAATCTTAGAGTACTTGCAATTGTAAATCATGGTGGTACCGTTGGTCCTAGCTGGTTGTGTCTTGACATCTGGTTAACAAGTTTAGAGACTCTCACTCTAGCAGGCGTATGTTGGAGCACTCTCCCGCCTTTTGCGAAGCTACCAAATCTCAAGGGACTCAAACTGATGAGAATTTCTGGAATGCATCAGTTTGGGTCTCTATGTGGTGGCACTCCAGGGAAATGTTTTATGCGCTTGAAGACAGTTGAGTTTTATGAGATGCCAGAACTTGCTGAATGGGTTGTGGAATCTAATTGCCATTCCTTTCCAAGTCTTGAAGAAATCAGATGCAGAAATTGTCCCAACCTCCGTGTGATGCCCTTCTCGGAGGTATCTTTCACCAATTTGCGCACACTTTTTGTTTCCAGGTGCCCCAAGATGTCTCTGCCCTCCATGCCTCACACCTCCACACTGACAGATCTGAATGTTGGAATAGGTGATTCAGAAGGGTTGCATTATGATGGAAAGAAATTGATTGTTATAGGGTATGGCGGTGCTTTGGCCTCCCACAATCTGGATACAGTAGAAGATATGATTGTCGAAAGATGCGACGGTTTGTTCCCTGAAGATTTGGATGGCAGTTTTGTCTTCCGTTCAGTTAAGAATCTCACATTACATGTATCTCGTCTTACCAGCAGCAAATCATCATCGTCAAAAGTGTTAAACTGTTTCCCAGCTCTTTCTGTGTTGGTGATAGTTGGCTATGAGGAATGTGTAATGCAGTTCCCATCATCCAGCTCACTGCAGAAACTTACCTTCTCAGGCTGCCGGGGCCTGGTTCTTGTGCCTGAGGAGAAGGAGAATGGAGGAGGAATTCAGGAGGACAACTCATTGCTCCAATCATTAACAATAGTGGGATGTGGCAAACTCTTCTCTCGTTGGCCCATGGGAATGGGAGAATCAGAGACCATTTGCCCTTTCCCTGCTTCCCTGAAGAAACTTGATGTTTTCCAAGAGCCAAGCATGAAGTCAATGGCTCTGCTCTCAAACCTCACGTCTCTCACCACTCTACAGCTAAACTACTGCAGTAATTTAACAGTGGATGGATTCAATCCTCTCATCGCAGTCAACCTCATAGAGCTGCAAGTGCATAGGTGCAACACCTTAGCAGCAGATATGCTCTCAGAGGCGGCCTCTCACTCTCAGAGGGCCAAATTATTGCCTGCAGGTTACATCTCTAGATTGGAGAAACTCAATGTGGATAACAACTGTGGATTGCTTGTTGCTCCTATTTGCAACCTCCTCGCCCCGGCCCTCCACACACTTGTATTCTGGATTGATGAAACGATGGAAAGCTTGACGGAAGAGCAAGAGAAAGCGCTGCAGCTCCTCACCTCCCTCCAGAATCTAACATTTTTCAGATGCAGGGGTCTACAGTCCCTTCCTCAAGGGTTGCATCGCCTTTCTTCTCTCAAGGAGTTATGTGTCCGTGGGTGTCTAAAAATCCAATCGTTGCCCAAGGAGGGCCTCCCGCTTTCGCTGAGAAGACTAAAGATGAATTGGCGCAGCGCTGAGATAAACGAGCAAATTGAGAAAATCAAAAGAAGCAACCCAGATTTATCCGTCTCGTATTGCTAA


Protein sequences

Name Description Sequence
Lr1 disease resistance protein Lr1 disease resistance protein [Triticum aestivum].

MAAALGSAATLLGKVFTMLSAAPVAAYVDSLELGHNSQQIRAKLAHTRGLLHNAQAQVSDVGHNPGLQELLPALSRNADEAEDLLDELHYFQIHDRLHATNYAATQANFLRHARNALRHTATSSWAACFSCSSAQDDSDSTSGDDELRFHRVIFSRKFKSVLQDMQTHCDSVSDLLGTIPTSSMPVAVHRPQIGSTIIQDTLYGRRHTFEETVNRIFSCKHPVSVLPIVGPGGIGKTTFAQHLYNDARTEEHFQVRVWVCVSTDFNVLKLTREILACIPATEEGGSSSVANETTNLDHLQRSIVRRLKSKRFLIVLDDIWKCDSQDQWKTLLAPFTKGETKGSMLLVTTRFPKLAQMMETIDPLELLGLESNDFFTFFEACIFGEDNKPEHFEDELAGIAQKIADKLKGSPLAAKTVGRLLHKDLSQKHWNGVLEKHQWLKQQNNDDIMPSLKISYDCLPFDLKKCFSYCGLFPEDHWFTSSEINHFWVAVGIIDSDHQADRNYLEELVDNGFLMKKKEYYLDDRCKQKEFDCYVMHDLMHELSKSVSAQECLNISGFDFRADAIPQSVRHLSINIEDRYDANFEEEMSKLREKIDIANVRTLMIFREYEEERTAKILKDSFKEINSLRVLFIVVKSAQSFPDMFSKLIHLQYLKISSPHIDGEMRLPSTLSRFYHLKFLDLDDWRGSSDLPEDFSHLENLHDFRAESKLHSNIRNVGKMKHLQRLEEFHVKKESMGFELSELGPLTELEGGLTVRGLEHVATKEEATAAKLMLKRNLKQLELLWDRDLGGPTTDADILDALQPHSNLRVLAIVNHGGTVGPSWLCLDIWLTSLETLTLAGVCWSTLPPFAKLPNLKGLKLMRISGMHQFGSLCGGTPGKCFMRLKTVEFYEMPELAEWVVESNCHSFPSLEEIRCRNCPNLRVMPFSEVSFTNLRTLFVSRCPKMSLPSMPHTSTLTDLNVGIGDSEGLHYDGKKLIVIGYGGALASHNLDTVEDMIVERCDGLFPEDLDGSFVFRSVKNLTLHVSRLTSSKSSSSKVLNCFPALSVLVIVGYEECVMQFPSSSSLQKLTFSGCRGLVLVPEEKENGGGIQEDNSLLQSLTIVGCGKLFSRWPMGMGESETICPFPASLKKLDVFQEPSMKSMALLSNLTSLTTLQLNYCSNLTVDGFNPLIAVNLIELQVHRCNTLAADMLSEAASHSQRAKLLPAGYISRLEKLNVDNNCGLLVAPICNLLAPALHTLVFWIDETMESLTEEQEKALQLLTSLQNLTFFRCRGLQSLPQGLHRLSSLKELCVRGCLKIQSLPKEGLPLSLRRLKMNWRSAEINEQIEKIKRSNPDLSVSYC

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF28
51-862 PTHR11017:SF28

LHNAQAQVSDVGHNPGLQELLPALSRNADEAEDLLDELHYFQIHDRLHATNYAATQANFLRHARNALRHTATSSWAACFSCSSAQDDSDSTSGDDELRFHRVIFSRKFKSVLQDMQTHCDSVSDLLGTIPTSSMPVAVHRPQIGSTIIQDTLYGRRHTFEETVNRIFSCKHPVSVLPIVGPGGIGKTTFAQHLYNDARTEEHFQVRVWVCVSTDFNVLKLTREILACIPATEEGGSSSVANETTNLDHLQRSIVRRLKSKRFLIVLDDIWKCDSQDQWKTLLAPFTKGETKGSMLLVTTRFPKLAQMMETIDPLELLGLESNDFFTFFEACIFGEDNKPEHFEDELAGIAQKIADKLKGSPLAAKTVGRLLHKDLSQKHWNGVLEKHQWLKQQNNDDIMPSLKISYDCLPFDLKKCFSYCGLFPEDHWFTSSEINHFWVAVGIIDSDHQADRNYLEELVDNGFLMKKKEYYLDDRCKQKEFDCYVMHDLMHELSKSVSAQECLNISGFDFRADAIPQSVRHLSINIEDRYDANFEEEMSKLREKIDIANVRTLMIFREYEEERTAKILKDSFKEINSLRVLFIVVKSAQSFPDMFSKLIHLQYLKISSPHIDGEMRLPSTLSRFYHLKFLDLDDWRGSSDLPEDFSHLENLHDFRAESKLHSNIRNVGKMKHLQRLEEFHVKKESMGFELSELGPLTELEGGLTVRGLEHVATKEEATAAKLMLKRNLKQLELLWDRDLGGPTTDADILDALQPHSNLRVLAIVNHGGTVGPSWLCLDIWLTSLETLTLAGVCWSTLPPFAKLPNLKGLKLM

HMMPanther: PTHR11017
51-862 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LHNAQAQVSDVGHNPGLQELLPALSRNADEAEDLLDELHYFQIHDRLHATNYAATQANFLRHARNALRHTATSSWAACFSCSSAQDDSDSTSGDDELRFHRVIFSRKFKSVLQDMQTHCDSVSDLLGTIPTSSMPVAVHRPQIGSTIIQDTLYGRRHTFEETVNRIFSCKHPVSVLPIVGPGGIGKTTFAQHLYNDARTEEHFQVRVWVCVSTDFNVLKLTREILACIPATEEGGSSSVANETTNLDHLQRSIVRRLKSKRFLIVLDDIWKCDSQDQWKTLLAPFTKGETKGSMLLVTTRFPKLAQMMETIDPLELLGLESNDFFTFFEACIFGEDNKPEHFEDELAGIAQKIADKLKGSPLAAKTVGRLLHKDLSQKHWNGVLEKHQWLKQQNNDDIMPSLKISYDCLPFDLKKCFSYCGLFPEDHWFTSSEINHFWVAVGIIDSDHQADRNYLEELVDNGFLMKKKEYYLDDRCKQKEFDCYVMHDLMHELSKSVSAQECLNISGFDFRADAIPQSVRHLSINIEDRYDANFEEEMSKLREKIDIANVRTLMIFREYEEERTAKILKDSFKEINSLRVLFIVVKSAQSFPDMFSKLIHLQYLKISSPHIDGEMRLPSTLSRFYHLKFLDLDDWRGSSDLPEDFSHLENLHDFRAESKLHSNIRNVGKMKHLQRLEEFHVKKESMGFELSELGPLTELEGGLTVRGLEHVATKEEATAAKLMLKRNLKQLELLWDRDLGGPTTDADILDALQPHSNLRVLAIVNHGGTVGPSWLCLDIWLTSLETLTLAGVCWSTLPPFAKLPNLKGLKLM

superfamily: SSF52540
185-444 SSF52540

PVAVHRPQIGSTIIQDTLYGRRHTFEETVNRIFSCKHPVSVLPIVGPGGIGKTTFAQHLYNDARTEEHFQVRVWVCVSTDFNVLKLTREILACIPATEEGGSSSVANETTNLDHLQRSIVRRLKSKRFLIVLDDIWKCDSQDQWKTLLAPFTKGETKGSMLLVTTRFPKLAQMMETIDPLELLGLESNDFFTFFEACIFGEDNKPEHFEDELAGIAQKIADKLKGSPLAAKTVGRLLHKDLSQKHWNGVLEKHQWLKQQN

HMMPfam: PF00931
IPR002182
208-498 NB-ARC,NBS
NB-ARC

TFEETVNRIFSCKHPVSVLPIVGPGGIGKTTFAQHLYNDARTEEHFQVRVWVCVSTDFNVLKLTREILACIPATEEGGSSSVANETTNLDHLQRSIVRRLKSKRFLIVLDDIWKCDSQDQWKTLLAPFTKGETKGSMLLVTTRFPKLAQMMETIDPLELLGLESNDFFTFFEACIFGEDNKPEHFEDELAGIAQKIADKLKGSPLAAKTVGRLLHKDLSQKHWNGVLEKHQWLKQQNNDDIMPSLKISYDCLPFDLKKCFSYCGLFPEDHWFTSSEINHFWVAVGIIDSDH

Gene3D: G3DSA:3.40.50.300
218-351 G3DSA:3.40.50.300

SCKHPVSVLPIVGPGGIGKTTFAQHLYNDARTEEHFQVRVWVCVSTDFNVLKLTREILACIPATEEGGSSSVANETTNLDHLQRSIVRRLKSKRFLIVLDDIWKCDSQDQWKTLLAPFTKGETKGSMLLVTTRF

FPrintScan: PR00364
IPR000767
225-240 DISEASERSIST
Disease resistance protein

VLPIVGPGGIGKTTFA

FPrintScan: PR00364
IPR000767
306-320 DISEASERSIST
Disease resistance protein

RLKSKRFLIVLDDIW

FPrintScan: PR00364
IPR000767
407-421 DISEASERSIST
Disease resistance protein

LKGSPLAAKTVGRLL

superfamily: SSF52058
535-962 SSF52058,LRR

VMHDLMHELSKSVSAQECLNISGFDFRADAIPQSVRHLSINIEDRYDANFEEEMSKLREKIDIANVRTLMIFREYEEERTAKILKDSFKEINSLRVLFIVVKSAQSFPDMFSKLIHLQYLKISSPHIDGEMRLPSTLSRFYHLKFLDLDDWRGSSDLPEDFSHLENLHDFRAESKLHSNIRNVGKMKHLQRLEEFHVKKESMGFELSELGPLTELEGGLTVRGLEHVATKEEATAAKLMLKRNLKQLELLWDRDLGGPTTDADILDALQPHSNLRVLAIVNHGGTVGPSWLCLDIWLTSLETLTLAGVCWSTLPPFAKLPNLKGLKLMRISGMHQFGSLCGGTPGKCFMRLKTVEFYEMPELAEWVVESNCHSFPSLEEIRCRNCPNLRVMPFSEVSFTNLRTLFVSRCPKMSLPSMPHTSTLTDLNV

Gene3D: G3DSA:3.80.10.10
618-735 G3DSA:3.80.10.10

LKDSFKEINSLRVLFIVVKSAQSFPDMFSKLIHLQYLKISSPHIDGEMRLPSTLSRFYHLKFLDLDDWRGSSDLPEDFSHLENLHDFRAESKLHSNIRNVGKMKHLQRLEEFHVKKES

Gene3D: G3DSA:3.80.10.10
797-948 G3DSA:3.80.10.10

DILDALQPHSNLRVLAIVNHGGTVGPSWLCLDIWLTSLETLTLAGVCWSTLPPFAKLPNLKGLKLMRISGMHQFGSLCGGTPGKCFMRLKTVEFYEMPELAEWVVESNCHSFPSLEEIRCRNCPNLRVMPFSEVSFTNLRTLFVSRCPKMSL

FPrintScan: PR00364
IPR000767
930-946 DISEASERSIST
Disease resistance protein

VSFTNLRTLFVSRCPKM

superfamily: SSF52047
1035-1305 SSF52047,LRR

SSSKVLNCFPALSVLVIVGYEECVMQFPSSSSLQKLTFSGCRGLVLVPEEKENGGGIQEDNSLLQSLTIVGCGKLFSRWPMGMGESETICPFPASLKKLDVFQEPSMKSMALLSNLTSLTTLQLNYCSNLTVDGFNPLIAVNLIELQVHRCNTLAADMLSEAASHSQRAKLLPAGYISRLEKLNVDNNCGLLVAPICNLLAPALHTLVFWIDETMESLTEEQEKALQLLTSLQNLTFFRCRGLQSLPQGLHRLSSLKELCVRGCLKIQSLP

Gene3D: G3DSA:3.80.10.10
1056-1080 G3DSA:3.80.10.10

ECVMQFPSSSSLQKLTFSGCRGLVL

Gene3D: G3DSA:3.80.10.10
1095-1306 G3DSA:3.80.10.10

NSLLQSLTIVGCGKLFSRWPMGMGESETICPFPASLKKLDVFQEPSMKSMALLSNLTSLTTLQLNYCSNLTVDGFNPLIAVNLIELQVHRCNTLAADMLSEAASHSQRAKLLPAGYISRLEKLNVDNNCGLLVAPICNLLAPALHTLVFWIDETMESLTEEQEKALQLLTSLQNLTFFRCRGLQSLPQGLHRLSSLKELCVRGCLKIQSLPK


Diseases

Disease Pathogen Avirulence gene
Wheat leaf rust Puccinia triticina

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox