PRGDB00061471 (VAT)

From PRG Wiki
Revision as of 22:32, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
VAT
Gene Type Reference_R-Genes,_manually_curated
GenBank
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Cucumis melo

Comment?

DNA Sequence

ATTATTATGGTTCATTCCTCGTGGTTTTTTAGCTCTTCAAGTATTTTTGTAGGTTTTGATCCTTTTCAAGCTCAAGAACAGAGGATAATAATGGACATCCTTATTTCAGTCACTGCAAAAATTGCCGAATACACTGTTGAGCCTGTTGGACGCCAACTTGGTTATGTATTTTTCATTCGTTCCAACTTTCAAAAACTTAAGACTCAAGTAGAAAAGCTGAAGATTACAAGAGAGTCTGTGCAACACAAGATCCATAGTGCAAGAAGAAATGCTGAAGACATAAAACCTGCCGTTGAGGAATGGTTGAAAAAGGTCGATGACTTTGTCCGAGAATCTGACGAGATATTAGCCAATGAAGGTGGACATGGTGGACTCTGTTCCACCTATTTGGTCCAACGACACAAGTTAAGTAGAAAAGCAAGCAAAATGGTAGATGAGGTTCTTGAGATGAAAAATGAGGGGGAAAGTTTTGATATGGTATCCTATAAAAGTGTTATCCCATCAGTTGATTGTTCACTTCCAAAAGTGCCTGACTTTCTTGACTTTGAGTCAAGAAAGTCGATTATGGAACAAATCATGGATGCACTATCTGATGGTAATGTCCATAGGATTGGAGTATATGGGATGGGGGGTGTTGGCAAAACAATGCTAGTGAAGGATATTTTAAGAAAAATTGTGGAGAGTAAGAAGCCTTTTGATGAGGTGGTAACATCCACGATCAGCCAAACACCAGATTTTAGAAGTATCCAAGGACAACTAGCTGACAAGCTAGGTTTGAAATTCGAACAAGAAACAATAGAAGGAAGGGCTACTATTCTACGAAAGAGGTTAAAGATGGAGAGAAGTATCCTAGTTGTGTTGGATGATGTTTGGGAGTATATTGATTTGGAAACTATAGGAATTCCAAGTGTTGAAGATCATACGGGGTGCAAGATCTTGTTTACCACTAGGATTAAACATTTGATCTCAAATCAAATGTGCGCCAATAAAATTTTTGAGATAAAAGTTTTAGGAAAAGATGAGTCATGGAATTTATTTAAGGCAATGGCAGGTGACATTGTTGATGCAAGTGATTTGAAGCCTATAGCCATTCGAATTGTGAGAGAATGTGCAGGTTTGCCTATTGCTATTACTACTGTTGCTAAGGCATTACGAAATAAACCTTCCGACATTTGGAATGATGCCTTAGATCAGCTTAAAACTGTTGATGTGGGTATGGCAAACATTGGAGAAATGGAAAAGAAAGTGTATTTGTCACTAAAACTGAGTTACGATTGCTTGGGATATGAAGAGGTGAAGTTATTATTCTTGTTATGCAGCATGTTTCCAGAAGACTTTAGCATTGACGTGGAAGGGTTGCATGTATATGCCATGGGCATGGGATTCTTACATGGTGTTGATACTGTGGTAAAAGGACGACGTAGGATAAAAAAATTGGTTGATGATCTTATATCTTCTTCTTTGCTTCAACAATATTCTGAGTATGGGTGCAATTATGTGAAAATGCATGATATGGTTCGTGATGTAGCCCTATTAATTGCATCTAAGAATGAACACGTACGTACATTGAGCTATGTGAAAAGATCGAATGAAGAATGGGAAGAAGAGAAACTATTGGGTAATCATACCGCAGTGTTCATTGATGGTTTACATTATCCTCTCCCGAAGTTAACGTTACCCAAAGTTCAATTATTAAGGTTAGTTGCAAAATATTGTTGGGAACATAATAAGCGTGTGTCGGTGGTAGAAACTTTTTTTGAAGAAATGAAAGAGCTCAAAGGTTTAGTAGTAGAAAACGTAAATATATCATTGATGCAACGACCATCTGATGTTTACTCCTTAGCAAACATCAGAGTATTACGTTTGGAAAGATGTCAATTATTAGGGAGCATAGATTGGATTGGTGAATTAAAAAAGCTTGAAATTCTTGATTTTAGTGAATCTAACATCACACAAATTCCTACAACCATGAGCCAATTGACACAGCTAAAAGTGTTGAATTTATCTTCTTGTGAACAACTTGAGGTAATTCCACCAAATATTCTTTCAAAGTTGACAAAATTGGAAGAATTAGATCTGGAAACTTTTGATGGATGGGAAGGAGAAGAATGGTATGAAGGAAGGAAAAATGCTAGCCTTTCTGAACTCAAGTGCTTGCGACACCTTTATGCTTTAAACTTAACCATTCAAGATGAAGAAATTATGCCAGAAAACTTGTTCTTAGTTGGGAAGTTGAAGCTTCAAAAATTCAACATTTGTATTGGTTGCGAAAGCAAATTAAAGTATACTTTTGCATACAAGAACAGAATCAAAAACTTCATTGGAATCAAGATGGAATCAGGAAGGTGCTTGGATGATTGGATAAAAAATTTGTTAAAGAGGTCGGACAATGTGCTTTTGGAAGGATCAGTTTGTTCAAAGGTTCTCCACTCAGAATTGGTAGGTGCCAATAACTTCGTATCACTTCCTAATTTGGAGAAGTTGGAAATTGTGAATGCAAAGAGTTTGAAGATGATATGGAGCAATAACGTGCCAATTCTTAATTCCTTTTCCAAACTCGAGGAAATAAAAATTTATTCATGCAACAATCTTCAAAAAGTATTATTTCCTCCAAATATGATGGACATTCTCACATGCCTTAAAGTCTTAGAGATCAAAAATTGTGATTTGTTGGAAGGGATATTTGAAGCGCAAGAGCCAATTAGTGTTGTTGAGAGCAATAATTTACCCATTCTTAATTCCTTTTCCAAACTCGAGGAAATAAGAATTTGGTCATGCAACAATCTTCAAAAAGTATTATTTCCTTCAAATATGATGGGCATTCTTCCATGCCTTAAAGTCTTAGATATTAGAGGTTGTGAATTGTTGGAAGGGATATTTGAAGTGCAAGAGCCAATTAGTGTTGTTGAGAGCAATAGTGTACCCATTCTTAATTCCTTTTCCAAACTCGAGAAAATAAGAATTTGGTCATGCAACAATCTTCAAAAAATATTATTTCCTTCAAATATGATGGGCATTCTTACATGCCTTAAAGTCTTAGAGATCAGAGATTGTGAATTGTTGGAAGGGATATTTGAAGTGCAAGAGCCAATTAGTGTTGTTGAGAGCAATAATTTACCCATTCTTAATTCCTTTTCCAAACTCGAGGAAATAAGAATTGGGTCATGCAACAATCTTCAAAAAGTATTATTTCCTCCAAATATGATGGGCATTCTTACATGCCTTAAAGTCTTAGAGATTAGACATTGTAATTTGTTGGAAGGGATATTTGAAGTGCAAGAGCCAATTAGTATTGTTGAAGCGAGTCCTATCTTGCTCCAAAATTTATCTTCGTTGATGTTATGTAATCTTCCAAACCTTGAGTACGTGTGGAGCAAAAATCCTTATGAACTTCTGAGTTTGGAAAATATAAAAAGTTTGACCATTGATAAATGTCCAAGACTTAGAAGAGAATACTCAGTCAAAATTCTAAAGCAACTTGAAGATGTAAGCATAGATATCAAACAATTGATGAAGGTTATTGAGAAGGAAAAGTCAGCACATCATAATATGTTGGAATCAAAGCAATGGGAGACTTCATCTTCTTCTAAGGATGGGGTTCTACGGCTGGGAGATGGTTCTAAGTTGTTTCCAAATCTTAAAAGTTTGAAGCTATATGGTTTTGTTGATTATAACTCAACCCATTTACCAATGGAAATGTTGCAAATCTTATTCCAACTTGTAGTCTTTGAATTGGAAGGAGCATTTCTTGAAGAAATTTTCCCCAGCAACATACTGATTCCAAGCTATATGGTTTTAAGAAGATTAGCTCTATCTAAACTACCCAAGCTTAAGCATTTGTGGAGTGAAGAATGCTCACAAAACAATATCACCTCAGTTCTTCAACATTTGATTTCTCTAAGAATTTCAGAATGTGGAAGATTGAGTAGTTTACTGTCGTCAATAGTGTGTTTTACAAACTTGAAACATCTTCGGGTTTATAAATGTGATGGACTAACCCATTTGCTGAATCCTTCGGTGGCTACAACGCTTGTGCAACTTGAGTCTTTGACAATAGAAGAATGCAAAAGGATGAGTAGTGTAATTGAGGGAGGATCAACCGAAGAAGATGGAAATGATGAAATGGTTGTATTCAACAACCTACAACATTTATACATTTTTAATTGTTCCAACCTAACAAGCTTTTATTGTGGGAGATGCATTATTAAATTTCCATGTTTGAGGCAAGTAGACATTTGGAACTGTTCTGAAATGAAGGTCTTTTCGCTTGGAATTGTAAGCACACCTCGATTGAAATATGAAAATTTTTCTTTAAAGAATGATTACGATGATGAACGGTGTCATCCAAAATATCCCAAAGATATGTTGGTGGAAGATATGAATGTCATCACCAGAGAATATTGGGAGGATAATGTTGATACCGGAATTCCAAATTTATTTGCCGAACAGAGTTTGGAGGAAAACCGATCTGAAAATTCTTCTTCTTCGAAGAATAATGTTGAGAAAGAATAAGGAATTATATGGATATTGTTGTACACTACTTAATATATCATTTCATCCACAAGGAAAAGGAAGCTGCCAAATACCTACCTCAATCCTAGCAGATGCGTTCTTTGCAAGTTGGCTGTCAAAGACTTGAACCATATTTTCACAACCTGTGCCAATTCGCAAATAGCCTCTGGGTCAAACTGCACGACAAAATTGGTGGAAACTTTGATACAAACAGTATCAAAGCCCTCTGTTGGTCTCTTGGCTCGCTGAAACAATCAAACAGAAAGAACATCATTCTCTCGATGTAGGTGTGGATCTTCTTTAGTCCATTTGGGTGGAAAGAAACAATAGGATTTTCATAGACACAGAAAGAAGCTTAGTCACATTTGGGAAGATATCGAAACTTTGATTGGACCATGGTCGAGTAGAAACAAAATGTTCAAAGACTACAATCCAACATCAATCTTTAAACTTTAGAGCTTTGTTAGATTAATGTTTGTTGTATATGGCTTCCCTGTAGCCAAAGAAATATACATTGTAACAATGGTTTGATGAAATGATAATGAAGTGGTATGGTGTGTTTCAATTGCAAAA


Protein sequences

Name Description Sequence
VAT

MDILISVTAKIAEYTVEPVGRQLGYVFFIRSNFQKLKTQVEKLKITRESVQHKIHSARRNAEDIKPAVEEWLKKVDDFVRESDEILANEGGHGGLCSTYLVQRHKLSRKASKMVDEVLEMKNEGESFDMVSYKSVIPSVDCSLPKVPDFLDFESRKSIMEQIMDALSDGNVHRIGVYGMGGVGKTMLVKDILRKIVESKKPFDEVVTSTISQTPDFRSIQGQLADKLGLKFEQETIEGRATILRKRLKMERSILVVLDDVWEYIDLETIGIPSVEDHTGCKILFTTRIKHLISNQMCANKIFEIKVLGKDESWNLFKAMAGDIVDASDLKPIAIRIVRECAGLPIAITTVAKALRNKPSDIWNDALDQLKTVDVGMANIGEMEKKVYLSLKLSYDCLGYEEVKLLFLLCSMFPEDFSIDVEGLHVYAMGMGFLHGVDTVVKGRRRIKKLVDDLISSSLLQQYSEYGCNYVKMHDMVRDVALLIASKNEHVRTLSYVKRSNEEWEEEKLLGNHTAVFIDGLHYPLPKLTLPKVQLLRLVAKYCWEHNKRVSVVETFFEEMKELKGLVVENVNISLMQRPSDVYSLANIRVLRLERCQLLGSIDWIGELKKLEILDFSESNITQIPTTMSQLTQLKVLNLSSCEQLEVIPPNILSKLTKLEELDLETFDGWEGEEWYEGRKNASLSELKCLRHLYALNLTIQDEEIMPENLFLVGKLKLQKFNICIGCESKLKYTFAYKNRIKNFIGIKMESGRCLDDWIKNLLKRSDNVLLEGSVCSKVLHSELVGANNFVSLPNLEKLEIVNAKSLKMIWSNNVPILNSFSKLEEIKIYSCNNLQKVLFPPNMMDILTCLKVLEIKNCDLLEGIFEAQEPISVVESNNLPILNSFSKLEEIRIWSCNNLQKVLFPSNMMGILPCLKVLDIRGCELLEGIFEVQEPISVVESNSVPILNSFSKLEKIRIWSCNNLQKILFPSNMMGILTCLKVLEIRDCELLEGIFEVQEPISVVESNNLPILNSFSKLEEIRIGSCNNLQKVLFPPNMMGILTCLKVLEIRHCNLLEGIFEVQEPISIVEASPILLQNLSSLMLCNLPNLEYVWSKNPYELLSLENIKSLTIDKCPRLRREYSVKILKQLEDVSIDIKQLMKVIEKEKSAHHNMLESKQWETSSSSKDGVLRLGDGSKLFPNLKSLKLYGFVDYNSTHLPMEMLQILFQLVVFELEGAFLEEIFPSNILIPSYMVLRRLALSKLPKLKHLWSEECSQNNITSVLQHLISLRISECGRLSSLLSSIVCFTNLKHLRVYKCDGLTHLLNPSVATTLVQLESLTIEECKRMSSVIEGGSTEEDGNDEMVVFNNLQHLYIFNCSNLTSFYCGRCIIKFPCLRQVDIWNCSEMKVFSLGIVSTPRLKYENFSLKNDYDDERCHPKYPKDMLVEDMNVITREYWEDNVDTGIPNLFAEQSLEENRSENSSSSKNNVEKE

Domains

Domain Start-End Description Sequence

Coil: coil
33-61 coiled-coil

FQKLKTQVEKLKITRESVQHKIHSARRNA

HMMPanther: PTHR23155
39-1385 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QVEKLKITRESVQHKIHSARRNAEDIKPAVEEWLKKVDDFVRESDEILANEGGHGGLCSTYLVQRHKLSRKASKMVDEVLEMKNEGESFDMVSYKSVIPSVDCSLPKVPDFLDFESRKSIMEQIMDALSDGNVHRIGVYGMGGVGKTMLVKDILRKIVESKKPFDEVVTSTISQTPDFRSIQGQLADKLGLKFEQETIEGRATILRKRLKMERSILVVLDDVWEYIDLETIGIPSVEDHTGCKILFTTRIKHLISNQMCANKIFEIKVLGKDESWNLFKAMAGDIVDASDLKPIAIRIVRECAGLPIAITTVAKALRNKPSDIWNDALDQLKTVDVGMANIGEMEKKVYLSLKLSYDCLGYEEVKLLFLLCSMFPEDFSIDVEGLHVYAMGMGFLHGVDTVVKGRRRIKKLVDDLISSSLLQQYSEYGCNYVKMHDMVRDVALLIASKNEHVRTLSYVKRSNEEWEEEKLLGNHTAVFIDGLHYPLPKLTLPKVQLLRLVAKYCWEHNKRVSVVETFFEEMKELKGLVVENVNISLMQRPSDVYSLANIRVLRLERCQLLGSIDWIGELKKLEILDFSESNITQIPTTMSQLTQLKVLNLSSCEQLEVIPPNILSKLTKLEELDLETFDGWEGEEWYEGRKNASLSELKCLRHLYALNLTIQDEEIMPENLFLVGKLKLQKFNICIGCESKLKYTFAYKNRIKNFIGIKMESGRCLDDWIKNLLKRSDNVLLEGSVCSKVLHSELVGANNFVSLPNLEKLEIVNAKSLKMIWSNNVPILNSFSKLEEIKIYSCNNLQKVLFPPNMMDILTCLKVLEIKNCDLLEGIFEAQEPISVVESNNLPILNSFSKLEEIRIWSCNNLQKVLFPSNMMGILPCLKVLDIRGCELLEGIFEVQEPISVVESNSVPILNSFSKLEKIRIWSCNNLQKILFPSNMMGILTCLKVLEIRDCELLEGIFEVQEPISVVESNNLPILNSFSKLEEIRIGSCNNLQKVLFPPNMMGILTCLKVLEIRHCNLLEGIFEVQEPISIVEASPILLQNLSSLMLCNLPNLEYVWSKNPYELLSLENIKSLTIDKCPRLRREYSVKILKQLEDVSIDIKQLMKVIEKEKSAHHNMLESKQWETSSSSKDGVLRLGDGSKLFPNLKSLKLYGFVDYNSTHLPMEMLQILFQLVVFELEGAFLEEIFPSNILIPSYMVLRRLALSKLPKLKHLWSEECSQNNITSVLQHLISLRISECGRLSSLLSSIVCFTNLKHLRVYKCDGLTHLLNPSVATTLVQLESLTIEECKRMSSVIEGGSTEEDGNDEMVVFNNLQHLYIFNCSNLTSFYCGRCIIKFPCLRQVDIWNC

Gene3D: G3DSA:3.40.50.300
152-294 no description

FESRKSIMEQIMDALSDGNVHRIGVYGMGGVGKTMLVKDILRKIVESKKPFDEVVTSTISQTPDFRSIQGQLADKLGLKFEQETIEGRATILRKRLKMERSILVVLDDVWEYIDLETIGIPSVEDHTGCKILFTTRIKHLISN

superfamily: SSF52540
155-369 P-loop containing nucleoside triphosphate hydrolases

RKSIMEQIMDALSDGNVHRIGVYGMGGVGKTMLVKDILRKIVESKKPFDEVVTSTISQTPDFRSIQGQLADKLGLKFEQETIEGRATILRKRLKMERSILVVLDDVWEYIDLETIGIPSVEDHTGCKILFTTRIKHLISNQMCANKIFEIKVLGKDESWNLFKAMAGDIVDASDLKPIAIRIVRECAGLPIAITTVAKALRNKPSDIWNDALDQL

HMMPfam: PF00931
IPR002182
156-434 NB-ARC,NBS
NB-ARC

KSIMEQIMDALSDGNVHRIGVYGMGGVGKTMLVKDILRKIVESKKPFDEVVTSTISQTPDFRSIQGQLADKLGLKFEQETIEGRATILRKRLKMERSILVVLDDVWEYIDLETIGIPSVEDHTGCKILFTTRIKHLISNQMCANKIFEIKVLGKDESWNLFKAMAGDIVDASDLKPIAIRIVRECAGLPIAITTVAKALRNKPSDIWNDALDQLKTVDVGMANIGEMEKKVYLSLKLSYDCLGYEEVKLLFLLCSMFPEDFSIDVEGLHVYAMGMGFLH

FPrintScan: PR00364
IPR000767
173-188 DISEASERSIST
Disease resistance protein

RIGVYGMGGVGKTMLV

FPrintScan: PR00364
IPR000767
247-261 DISEASERSIST
Disease resistance protein

LKMERSILVVLDDVW

FPrintScan: PR00364
IPR000767
340-354 DISEASERSIST
Disease resistance protein

CAGLPIAITTVAKAL

superfamily: SSF52058
471-1007 L domain-like,LRR

KMHDMVRDVALLIASKNEHVRTLSYVKRSNEEWEEEKLLGNHTAVFIDGLHYPLPKLTLPKVQLLRLVAKYCWEHNKRVSVVETFFEEMKELKGLVVENVNISLMQRPSDVYSLANIRVLRLERCQLLGSIDWIGELKKLEILDFSESNITQIPTTMSQLTQLKVLNLSSCEQLEVIPPNILSKLTKLEELDLETFDGWEGEEWYEGRKNASLSELKCLRHLYALNLTIQDEEIMPENLFLVGKLKLQKFNICIGCESKLKYTFAYKNRIKNFIGIKMESGRCLDDWIKNLLKRSDNVLLEGSVCSKVLHSELVGANNFVSLPNLEKLEIVNAKSLKMIWSNNVPILNSFSKLEEIKIYSCNNLQKVLFPPNMMDILTCLKVLEIKNCDLLEGIFEAQEPISVVESNNLPILNSFSKLEEIRIWSCNNLQKVLFPSNMMGILPCLKVLDIRGCELLEGIFEVQEPISVVESNSVPILNSFSKLEKIRIWSCNNLQKILFPSNMMGILTCLKVLEIRDCELLEGIFEVQEPISVVESN

Gene3D: G3DSA:3.80.10.10
545-697 no description

HNKRVSVVETFFEEMKELKGLVVENVNISLMQRPSDVYSLANIRVLRLERCQLLGSIDWIGELKKLEILDFSESNITQIPTTMSQLTQLKVLNLSSCEQLEVIPPNILSKLTKLEELDLETFDGWEGEEWYEGRKNASLSELKCLRHLYALNL

HMMPfam: PF13855
609-664 LRR_8,Leucine rich repeat

KLEILDFSESNITQIPTTMSQLTQLKVLNLSSCEQLEVIPPNILSKLTKLEELDLE

FPrintScan: PR00364
IPR000767
628-644 DISEASERSIST
Disease resistance protein

SQLTQLKVLNLSSCEQL

Seg: seg
652-665 seg

LSKLTKLEELDLET

superfamily: SSF52047
1009-1256 RNI-like,LRR

LPILNSFSKLEEIRIGSCNNLQKVLFPPNMMGILTCLKVLEIRHCNLLEGIFEVQEPISIVEASPILLQNLSSLMLCNLPNLEYVWSKNPYELLSLENIKSLTIDKCPRLRREYSVKILKQLEDVSIDIKQLMKVIEKEKSAHHNMLESKQWETSSSSKDGVLRLGDGSKLFPNLKSLKLYGFVDYNSTHLPMEMLQILFQLVVFELEGAFLEEIFPSNILIPSYMVLRRLALSKLPKLKHLWSEECS

Gene3D: G3DSA:3.80.10.10
1154-1403 no description

MLESKQWETSSSSKDGVLRLGDGSKLFPNLKSLKLYGFVDYNSTHLPMEMLQILFQLVVFELEGAFLEEIFPSNILIPSYMVLRRLALSKLPKLKHLWSEECSQNNITSVLQHLISLRISECGRLSSLLSSIVCFTNLKHLRVYKCDGLTHLLNPSVATTLVQLESLTIEECKRMSSVIEGGSTEEDGNDEMVVFNNLQHLYIFNCSNLTSFYCGRCIIKFPCLRQVDIWNCSEMKVFSLGIVSTPRLKY

superfamily: SSF52047
1180-1439 RNI-like,LRR

FPNLKSLKLYGFVDYNSTHLPMEMLQILFQLVVFELEGAFLEEIFPSNILIPSYMVLRRLALSKLPKLKHLWSEECSQNNITSVLQHLISLRISECGRLSSLLSSIVCFTNLKHLRVYKCDGLTHLLNPSVATTLVQLESLTIEECKRMSSVIEGGSTEEDGNDEMVVFNNLQHLYIFNCSNLTSFYCGRCIIKFPCLRQVDIWNCSEMKVFSLGIVSTPRLKYENFSLKNDYDDERCHPKYPKDMLVEDMNVITREYWE

Seg: seg
1452-1473 seg

EQSLEENRSENSSSSKNNVEKE


Diseases

Disease Pathogen Avirulence gene
Melon aphid disease Aphis gossypii




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox