PRGDB00061556 (disease resistance protein)

From PRG Wiki
Revision as of 14:40, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438148 (FJ842783)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL36 disease resistance protein gene, complete cds.

DNA Sequence

ATGGGTGATTCCAGTGGACAAACTCGGGAGCGATGGAGCTACGATGTGTTCTTAAGTTTCCGTGGACCAGATGTGCGCAACGGTTTCTTAAGCCATCTCTACCAGAGTCTAGTGACATCTGGTATATACACGTTCAAGGACGATGAAGAACTAGAAAAAGGAGAAAGCATATCCCCGGAGCTGAGGAAGGCCATTGAAAACTCCAAAATTCACCTTGTTGTTTTATCCGAGAGCTATGCTTCATCATCGTGGTGCCTTGATGAGCTCGTGCACATGATGCGGCGCTTGAAAAACAACCCCGGACACCTGGTTTTCCCAGTTTTCTACAAAATTGAGCCGTCGCATGTACGCAGACAAAGTGGACCATTTGGTGAATCCTTTCATAAACACCGTAGCCGTCATCGAGAGAGCAAGTTGAAGCAGTGGAGGAAAGCTTTGACCAGTATTGCAAATTTGAAAGGGTATCACAGTAGTAATGGGGATAATGATGCAGAATTGGTCGACCAATTGACTAGAGACATTCTCCGAGTGTTGCCTAGTTCATACTTGCATTTACCAACATATGCCGTTGGTATTAGACCACGTGTAGGTCGTATCAAAGAGCTAATGTGCTTTGGTTTGGATGATGTTCAGATTATTGGAATCTGGGGAATGGCTGGGATTGGAAGAAGTTTCCTAGAAAACTTTAGAGATTACTTCAAGAGACCTGATGGGAAGCTTCATCTTCAGAAGAAGCTTCTTTCGGATATCTTAAGAAAGGATGAAGCTGCGTTCAACAACATGGATCATGCGGTGAAACAAAGATTTCGCAACAAAAGGAGCAGCTTGACGCCCAAGGAACTTAACGCTGATGAAGCTCTTGATCTTGTAAGCTGGCATGCCTTTAGAAGCAGTGAACCTCCTGAAGAGTTTCTCCAGTTCCCGAAAAGATTGGTTGAATACTGTGGAGGACTACCCTTGGCTATGGAAGTCTTGGGTGCTTTTCTCTACAAAAGAAGCGTTTCGGAGTGGAAAAGCACGTTGAAAGCGTTGAAAAGAATACCGGATGATAACATTCAAGCAAAGCTTCAGATCAGCTTTGATGCGCTAAACGCATTACAGAAAGACATATTCTTGGATATTTCTTGCTTCTTCATTGGGATGGATAAAGACTATGTAGATTGCATCTTGGATGGATGCGAATTAGAGCCTGTCGCAGGACTCAAGGTGTTAAAGGAGAGGTGTCTCATTACGATCCATGATAACAGGCTGATGATGCATGACTTACTACGAGACATGGGAAGATATATTGTCCAAGGAACATCCAAGAAACATGTGAAGAACCGTGTGAAATGGAGTAGATTGTGGGACCGGGTTCATGTTATAGATGTATTGGAAAATTACTCCGGAACAGATGCAAATCATCCAAATCATGCAATTGAAGGACTCAGCTTGAAGGCTGAAGTTACGGCTGTTGAGAACTTGGAGGTTAAAGCGTTTTCAAATCTACGTAGGCTGAGACTGTTACAGCTCAGTCATGTAGTACTCAACGGAAGCTATGAAAACTTTCCAAAAGGTTTACGATGGCTTTGTTGGCTTGGGTTTCCTGAGGAATCTATCCCCATAAACTTACATTTGAGAAGTTTAGTTGTCATGGACATGCAGAACAGCAACCTTAAACGGCTTTGGGATCAAAAGCCTCATGATTCCCTTAAGGAGTTAAAGTACCTAGACCTCAGTCACTCTATCCAGCTTACAGAGACTCCAGACTTCTCTTATCTCCCAAACCTTGAGAAGCTCTTCTTGATAAACTGTCAAAGATTGGCTAAAGTTCACGAGTCCATAAAGGTTCTTCAAGGAAGCCTGATTCTATTAAATCTGAGTGGTTGCATCAAGCTTGGTGAACTCCCGTTGGAACTCTATACGTTGAAGTTGCTAGAAACCCTCATTCTCTCCGGATGCTCGCAACTTGAGAGATTGGATGATGCTTTAGGTGAACTAGAGTCCTTGACAATTCTCAAAGCTGATTATACTGCTATAACGCAAATCCCTTCCTCGAGTGATCAACTGAAAGAGTTATCTCTTCATGGCTGCAAGGAGTTATGGAAGGACAGACAGTACACCAACTCTGATGAAAGCTCTCAAGTGGCTCTGTTAAGCCCGCTCTCATTAAACGGTTTAATCTGCTTAAGGACTTTGCGTTTAGGTTACTGCAATCTATCGGATGAGTTGGTTCCTGTAAATCTTGGGAGTTTGTCTTCCCTTGAGGAACTTGACCTTCAAGGCAACAACTTTCGTAACTTGCAAACCGATTTTGCTGGTCTTCCAAGTCTACAGATTCTTAAATTGGATAATTGCTCAGAACTTCGATCCATGTTTAGTTTACCAAAGAAGTTGAGGTCTTTATACGCGAGAAACTGTACTGTGTTGGAAAGAACTCCAGACTTAAAAGAATGCTCTGTGTTGCAATCACTGCACCTCACAAATTGTTACAATCTCGTTGAGACCCCAGGGCTGGAGGAACTGAAAACGGTTGGAGTCATCCACATGGAAATGTGCAACAATGTACCTTATTCTGACAGAGAAAGAATCATGCAGGGATGGGCTGTTGGTGCCAATGGGGGAGTTTTTGTCCCGGGGTCGACCATTCCAGACTGGGTCAATTTCAAGAATGGGACACGCTCAATCTCTTTTACTGTCCCTGAACCAACTTTGAATTCTGTTCTGGTCGGGTTTACCGTGTGGACAACATACGTGAGTCAACAAGATGATGTGATGTCTGCATACATTCCAAAGATCACATTGAAGAATCAAACCAAGGTAGATGTGTGGAGCCGCAATCCAGCAACAGATCTCATTCGTATGTACCGTGAAAAACACATCTGGCAAGGGCACTTTTCAAATGAAGATTTCGTGTTAGAAACAGGGGATGAAGTGGAAGTTTCTGTGGATTTTGGAGATAAAGTCGCCATTCTTGAGACAGGACTAACTCTTGCTTACAGAGAAGTCCCTGAAGTCCCAAATGAACAACTAACTGAAATAGATGATGACGTTGATGATGAACTAGTCATACATGAAAGCCAAAGAAGACCTCCCAGGAAAATGGGAATGGGTTTAAAGACAGTTCTGGGGGCATTTGGTTTGTTGGCATTCATTGTTGTACTTGGTAAACATGCTAGACCCCTTCGCCGTCACAACCATCTCCGCAGGAATACAGCTGAAAAGGATAAGGAGGAAGATGCTACACTCCACCTTTTCTCTTTTTTAGATTGCTAG


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MGDSSGQTRERWSYDVFLSFRGPDVRNGFLSHLYQSLVTSGIYTFKDDEELEKGESISPELRKAIENSKIHLVVLSESYASSSWCLDELVHMMRRLKNNPGHLVFPVFYKIEPSHVRRQSGPFGESFHKHRSRHRESKLKQWRKALTSIANLKGYHSSNGDNDAELVDQLTRDILRVLPSSYLHLPTYAVGIRPRVGRIKELMCFGLDDVQIIGIWGMAGIGRSFLENFRDYFKRPDGKLHLQKKLLSDILRKDEAAFNNMDHAVKQRFRNKRSSLTPKELNADEALDLVSWHAFRSSEPPEEFLQFPKRLVEYCGGLPLAMEVLGAFLYKRSVSEWKSTLKALKRIPDDNIQAKLQISFDALNALQKDIFLDISCFFIGMDKDYVDCILDGCELEPVAGLKVLKERCLITIHDNRLMMHDLLRDMGRYIVQGTSKKHVKNRVKWSRLWDRVHVIDVLENYSGTDANHPNHAIEGLSLKAEVTAVENLEVKAFSNLRRLRLLQLSHVVLNGSYENFPKGLRWLCWLGFPEESIPINLHLRSLVVMDMQNSNLKRLWDQKPHDSLKELKYLDLSHSIQLTETPDFSYLPNLEKLFLINCQRLAKVHESIKVLQGSLILLNLSGCIKLGELPLELYTLKLLETLILSGCSQLERLDDALGELESLTILKADYTAITQIPSSSDQLKELSLHGCKELWKDRQYTNSDESSQVALLSPLSLNGLICLRTLRLGYCNLSDELVPVNLGSLSSLEELDLQGNNFRNLQTDFAGLPSLQILKLDNCSELRSMFSLPKKLRSLYARNCTVLERTPDLKECSVLQSLHLTNCYNLVETPGLEELKTVGVIHMEMCNNVPYSDRERIMQGWAVGANGGVFVPGSTIPDWVNFKNGTRSISFTVPEPTLNSVLVGFTVWTTYVSQQDDVMSAYIPKITLKNQTKVDVWSRNPATDLIRMYREKHIWQGHFSNEDFVLETGDEVEVSVDFGDKVAILETGLTLAYREVPEVPNEQLTEIDDDVDDELVIHESQRRPPRKMGMGLKTVLGAFGLLAFIVVLGKHARPLRRHNHLRRNTAEKDKEEDATLHLFSFLDC

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
2-155 TIR
Toll-Interleukin receptor

GDSSGQTRERWSYDVFLSFRGPDVRNGFLSHLYQSLVTSGIYTFKDDEELEKGESISPELRKAIENSKIHLVVLSESYASSSWCLDELVHMMRRLKNNPGHLVFPVFYKIEPSHVRRQSGPFGESFHKHRSRHRESKLKQWRKALTSIANLKGY

Gene3D: G3DSA:3.40.50.10140
10-149 G3DSA:3.40.50.10140

ERWSYDVFLSFRGPDVRNGFLSHLYQSLVTSGIYTFKDDEELEKGESISPELRKAIENSKIHLVVLSESYASSSWCLDELVHMMRRLKNNPGHLVFPVFYKIEPSHVRRQSGPFGESFHKHRSRHRESKLKQWRKALTSI

ProfileScan: PS50104
IPR000157
12-152 TIR
Toll-Interleukin receptor

WSYDVFLSFRGPDVRNGFLSHLYQSLVTSGIYTFKDDEELEKGESISPELRKAIENSKIHLVVLSESYASSSWCLDELVHMMRRLKNNPGHLVFPVFYKIEPSHVRRQSGPFGESFHKHRSRHRESKLKQWRKALTSIANL

HMMSmart: SM00255
IPR000157
13-152 TIR
Toll-Interleukin receptor

SYDVFLSFRGPDVRNGFLSHLYQSLVTSGIYTFKDDEELEKGESISPELRKAIENSKIHLVVLSESYASSSWCLDELVHMMRRLKNNPGHLVFPVFYKIEPSHVRRQSGPFGESFHKHRSRHRESKLKQWRKALTSIANL

HMMPfam: PF01582
IPR000157
16-147 TIR
Toll-Interleukin receptor

VFLSFRGPDVRNGFLSHLYQSLVTSGIYTFKDDEELEKGESISPELRKAIENSKIHLVVLSESYASSSWCLDELVHMMRRLKNNPGHLVFPVFYKIEPSHVRRQSGPFGESFHKHRSRHRESKLKQWRKALT

HMMPanther: PTHR11017:SF130
38-994 PTHR11017:SF130,DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS)

VTSGIYTFKDDEELEKGESISPELRKAIENSKIHLVVLSESYASSSWCLDELVHMMRRLKNNPGHLVFPVFYKIEPSHVRRQSGPFGESFHKHRSRHRESKLKQWRKALTSIANLKGYHSSNGDNDAELVDQLTRDILRVLPSSYLHLPTYAVGIRPRVGRIKELMCFGLDDVQIIGIWGMAGIGRSFLENFRDYFKRPDGKLHLQKKLLSDILRKDEAAFNNMDHAVKQRFRNKRSSLTPKELNADEALDLVSWHAFRSSEPPEEFLQFPKRLVEYCGGLPLAMEVLGAFLYKRSVSEWKSTLKALKRIPDDNIQAKLQISFDALNALQKDIFLDISCFFIGMDKDYVDCILDGCELEPVAGLKVLKERCLITIHDNRLMMHDLLRDMGRYIVQGTSKKHVKNRVKWSRLWDRVHVIDVLENYSGTDANHPNHAIEGLSLKAEVTAVENLEVKAFSNLRRLRLLQLSHVVLNGSYENFPKGLRWLCWLGFPEESIPINLHLRSLVVMDMQNSNLKRLWDQKPHDSLKELKYLDLSHSIQLTETPDFSYLPNLEKLFLINCQRLAKVHESIKVLQGSLILLNLSGCIKLGELPLELYTLKLLETLILSGCSQLERLDDALGELESLTILKADYTAITQIPSSSDQLKELSLHGCKELWKDRQYTNSDESSQVALLSPLSLNGLICLRTLRLGYCNLSDELVPVNLGSLSSLEELDLQGNNFRNLQTDFAGLPSLQILKLDNCSELRSMFSLPKKLRSLYARNCTVLERTPDLKECSVLQSLHLTNCYNLVETPGLEELKTVGVIHMEMCNNVPYSDRERIMQGWAVGANGGVFVPGSTIPDWVNFKNGTRSISFTVPEPTLNSVLVGFTVWTTYVSQQDDVMSAYIPKITLKNQTKVDVWSRNPATDLIRMYREKHIWQGHFSNEDFVLETGDEVEVSVDFGDKVAILETGLTLAYR

HMMPanther: PTHR11017
38-994 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VTSGIYTFKDDEELEKGESISPELRKAIENSKIHLVVLSESYASSSWCLDELVHMMRRLKNNPGHLVFPVFYKIEPSHVRRQSGPFGESFHKHRSRHRESKLKQWRKALTSIANLKGYHSSNGDNDAELVDQLTRDILRVLPSSYLHLPTYAVGIRPRVGRIKELMCFGLDDVQIIGIWGMAGIGRSFLENFRDYFKRPDGKLHLQKKLLSDILRKDEAAFNNMDHAVKQRFRNKRSSLTPKELNADEALDLVSWHAFRSSEPPEEFLQFPKRLVEYCGGLPLAMEVLGAFLYKRSVSEWKSTLKALKRIPDDNIQAKLQISFDALNALQKDIFLDISCFFIGMDKDYVDCILDGCELEPVAGLKVLKERCLITIHDNRLMMHDLLRDMGRYIVQGTSKKHVKNRVKWSRLWDRVHVIDVLENYSGTDANHPNHAIEGLSLKAEVTAVENLEVKAFSNLRRLRLLQLSHVVLNGSYENFPKGLRWLCWLGFPEESIPINLHLRSLVVMDMQNSNLKRLWDQKPHDSLKELKYLDLSHSIQLTETPDFSYLPNLEKLFLINCQRLAKVHESIKVLQGSLILLNLSGCIKLGELPLELYTLKLLETLILSGCSQLERLDDALGELESLTILKADYTAITQIPSSSDQLKELSLHGCKELWKDRQYTNSDESSQVALLSPLSLNGLICLRTLRLGYCNLSDELVPVNLGSLSSLEELDLQGNNFRNLQTDFAGLPSLQILKLDNCSELRSMFSLPKKLRSLYARNCTVLERTPDLKECSVLQSLHLTNCYNLVETPGLEELKTVGVIHMEMCNNVPYSDRERIMQGWAVGANGGVFVPGSTIPDWVNFKNGTRSISFTVPEPTLNSVLVGFTVWTTYVSQQDDVMSAYIPKITLKNQTKVDVWSRNPATDLIRMYREKHIWQGHFSNEDFVLETGDEVEVSVDFGDKVAILETGLTLAYR

FPrintScan: PR00364
IPR000767
212-227 DISEASERSIST
Disease resistance protein

IIGIWGMAGIGRSFLE

superfamily: SSF52540
254-352 SSF52540

DEAAFNNMDHAVKQRFRNKRSSLTPKELNADEALDLVSWHAFRSSEPPEEFLQFPKRLVEYCGGLPLAMEVLGAFLYKRSVSEWKSTLKALKRIPDDNI

HMMPfam: PF00931
IPR002182
263-382 NB-ARC,NBS
NB-ARC

HAVKQRFRNKRSSLTPKELNADEALDLVSWHAFRSSEPPEEFLQFPKRLVEYCGGLPLAMEVLGAFLYKRSVSEWKSTLKALKRIPDDNIQAKLQISFDALNALQKDIFLDISCFFIGMD

superfamily: SSF46785
350-459 SSF46785

DNIQAKLQISFDALNALQKDIFLDISCFFIGMDKDYVDCILDGCELEPVAGLKVLKERCLITIHDNRLMMHDLLRDMGRYIVQGTSKKHVKNRVKWSRLWDRVHVIDVLE

superfamily: SSF52058
418-847 SSF52058,LRR

MMHDLLRDMGRYIVQGTSKKHVKNRVKWSRLWDRVHVIDVLENYSGTDANHPNHAIEGLSLKAEVTAVENLEVKAFSNLRRLRLLQLSHVVLNGSYENFPKGLRWLCWLGFPEESIPINLHLRSLVVMDMQNSNLKRLWDQKPHDSLKELKYLDLSHSIQLTETPDFSYLPNLEKLFLINCQRLAKVHESIKVLQGSLILLNLSGCIKLGELPLELYTLKLLETLILSGCSQLERLDDALGELESLTILKADYTAITQIPSSSDQLKELSLHGCKELWKDRQYTNSDESSQVALLSPLSLNGLICLRTLRLGYCNLSDELVPVNLGSLSSLEELDLQGNNFRNLQTDFAGLPSLQILKLDNCSELRSMFSLPKKLRSLYARNCTVLERTPDLKECSVLQSLHLTNCYNLVETPGLEELKTVGVIHMEMCN

Gene3D: G3DSA:3.80.10.10
483-690 G3DSA:3.80.10.10

TAVENLEVKAFSNLRRLRLLQLSHVVLNGSYENFPKGLRWLCWLGFPEESIPINLHLRSLVVMDMQNSNLKRLWDQKPHDSLKELKYLDLSHSIQLTETPDFSYLPNLEKLFLINCQRLAKVHESIKVLQGSLILLNLSGCIKLGELPLELYTLKLLETLILSGCSQLERLDDALGELESLTILKADYTAITQIPSSSDQLKELSLHG

FPrintScan: PR00364
IPR000767
562-578 DISEASERSIST
Disease resistance protein

DSLKELKYLDLSHSIQL

Gene3D: G3DSA:3.80.10.10
714-844 G3DSA:3.80.10.10

PLSLNGLICLRTLRLGYCNLSDELVPVNLGSLSSLEELDLQGNNFRNLQTDFAGLPSLQILKLDNCSELRSMFSLPKKLRSLYARNCTVLERTPDLKECSVLQSLHLTNCYNLVETPGLEELKTVGVIHME

HMMPfam: PF13855
723-779 LRR_8,Leucine rich repeat

LRTLRLGYCNLSDELVPVNLGSLSSLEELDLQGNNFRNLQTDFAGLPSLQILKLDNC


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox