PRGDB00061565 (disease resistance protein)

From PRG Wiki
Revision as of 14:39, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438130 (FJ842774)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL34 disease resistance protein gene, complete cds.

DNA Sequence

ATGGATCCAGTTCAGAACCGAATGGCTTCGGATCGAAGCTTGAAGTACGATGTCTTCATCAGCTTCCGAGGACCAGACACCCGCAAAATATTCGTTGGCCATTTGTACGGATCACTTTCCATCAGGGGAATTTTTACCTTCAAAGACGATCGGAGGCTTGAGCCAGGAGATTCCATTACCGACGAACTCTGCCAAGCCATCCGGACATCAAGGTTTGCTGTCGTGGTTATCTCCAAGAACTACGCTACTTCAAGCTGGTGCCTAGATGAGCTTCAGTTGATCATGGAACTTGTCGAGAACAAGGAGATTGAAGTTTTTCCGATTTTCTATGAAGTAAAACCTTCCGATGTCAGACATCAGCAGCTCCTAGAAAGTTTCTCTTTACGAATGACTGAGAAGGTTCCTGGTTGGAAAAAAGCTCTCAAGGATATAGCCAACCGAAAGGGCATGGAATCCTCAAAATTCTCGGACGATGCCACGATGATTGAAGAAATAGTTCAAAACATTTCAAGCCGGTTGTTATCTATGTTGCCAATACGTTTCCGTGATGTTGTCGGGATGAGAGCTCACGTGAAAGTTCTCAGCCCTCTCTTGGACATGGACTCCAAGGATGATGCTCGTATCATAGGAATCGTTGGAACAGGAGGCATTGGTAAAACCACTATAGCAAAGTATCTCTACGAAACCCATAAACTTGGATTTTCACCTCATCATTATTTCATGGAGAACGTTGCGAAACTCTGTAGAGAACATGGTCTCTTACATCTACAAAATCAACTTCTTTCTAGTATCTTCCGTGAAAAGAATGTCATGCTGGAAAGCGTTGAACACGGAAGACAACAACTTGAGTTCAGGCTTAGAAACGCAAAAGTTTTTCTCGTCTTTGATGACGTTGATGATGTTAGACAGCTTGATGCCTTGGCAAAAGAGGTTCAGTGGTTTGCACCAGGGAGCCGAATCGTCATAACCACGCGGGATAAGAGCTTGCTTAACTCCTGTGAAGTGTACGACGTTGAGTACTTGGATGATGATAAAGCACTCCTACTCTTCCAGCAGATTGCTTTTAAAGGAGGACAACCACCTTCTAGTGTCTACTCAGATTTTTCAAGTCGTGCTTCGAAACTTGCTCAAGGTCTTCCTTTGGCCGTCAAGGCTTTGGGAAGTTCTCTCCGAGGGAAGTCCGAAATGGAGTGGGATAAGGCTTTACGTTCCTTTGAAAAGACTCCTTACGATAATATTCCAAGAATATTAAATATTAGCTACGAGAGCTTGGACGAACTTAGTAAGACTGCTTTTCTTCATGTGGCATGCCTTTTCAATGGAGAACTTGTCTCGCGTGTCAAGTCTCTTCTCCACCGTGGTGAAGATGGGATACGGGTTTTAGCGGAAAAGTCTCTCATCGATTTATCTACTAATGGCCGTATAGCCATGCACCATTTGTTGGAGAAAATGGGAAGACGGAACGAATCAGGCAACGACCTTTCCCTACAACCAATCTTGTGGCAGTGGTACGACATATGTCGACTTGCAGACAAAGCAGGAACGACAAGAACTGAAGGCATCGTGCTAGATGTTTCCGAAAGGCCTAATCATATAGACTGGAAAGTTTTCATGCAGATGGAGAATCTCAAATATCTGAAAATTTACAACCACAGGCGTTACAAAAGTTTAGATTCAAGGACACAGGGCAATCCAAACGAAATTTTACAACCTTATAAACTTAGATTGCTACAGTGGGATGCATATCCTTACACAACCTTGCCTTCCAGTATCAACACAGATTGTCTTGTAGAAGTAATTCTGTGTAACAGCAAGCTCACAACTCTTTGGAGTGGAAGTCCCCCGAGACTTTCGCATTTGAAAAGGCTGAATCTTACTGGATCTATGTACCTAAAAGAACTTCCAGATCTTAAGGAAGCAGTGTATCTCGAAGAGTTGATGCTGGAAGGTTGCATTTCCCTGACAAGGATTCCAGAGTCCATTTGTAGCCTACCTAGACTACAAAAACTTGATCTATCCAACTGTGATGGGCTAAAGAATCTAATTATCATAGTAAGGGAATCCGAAGCTACTTTCTTTGAAGGCAGAAGAAGCTTGCACGTTAGATCGGTCCACATGGATTTTCTTGATGCAGAACCGTTAGCAGAAGAGTCTCGAGACATTTCTCTTACAAATCTATCAATCAAGGGGAACTTAAAAATTGAGTTGAAGGTTATTGGAGGATATGCACAACATTTTTCGTTTGTTTCTGAGCAGCATATCCCTCATCAAGTAATGTTGTTGGAGCAGCAAACAGCTAGGCTCATGTCACATCCCTACAATTTTAAGTTGCTTCACATCGTGCAAGTTAACTGCAGTGAGCAAAGGGATCCTTTCGAGTGTTATAGCTTTTCATATTTTCCCTGGTTGATGGAGCTAAATCTAATCAACTTAAACATCGAAGAAATACCAGATGACATTCATCACATGCAAGTTCTAGAGAAGTTGAACCTAAGTGGAAACTTCTTCAGGGGTTTACCTTCATCAATGACTCATCTTACGAAGTTAAAACATGTGAGGCTTTGTAACTGTCGTAGACTTGAAGCTTTGCCACAACTATATCAGCTGGAGACGCTCACACTTTCTGATTGTACCAACCTCCACACATTGGTGAGCATTTCGCAGGCAGAACAAGACCATGGAAAATACAATTTGCTTGAGCTTCGTCTTGACAACTGCAAACATGTCGAGACATTGTCGGATCAGCTTCGGTTTTTTACAAAGTTGACGTATTTAGATATCAGTCGCCACGATTTTGAAACAGTGCCTACAAGCATCAAAGACCTATCCTCGCTGATAACTCTCTGCCTCAACTATTGCATGAAACTAAAATCACTTTCAGAGCTTCCATTGAGCATTAAGCACCTATATTCACATGGCTGCATGTCCTTAGAAACTTTCTCCCTTTCAGTTGATCATTCTGTTGATGACCTTGATCTCAGCCCTTGCTTCCAACCGAATCAGTTTTTAAGTCAATTCACTCGTTTTCCATCAGGAAGACGTAGTGAAGAGGTACAGCTATGTGCTTGCATCCAGAAACCTAAGATATTGAATACGCTTGATCGAGGGATGAGGAGTGTCAGAACAATCTACACAGAGCGTTTTAGCTCCGAAACCTTGAAACTAATGGCTTTTGCTCTATGTTTGGGTGTGCTCCTTCTATGTAAGACGATGGGCAATAGCTAG


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MDPVQNRMASDRSLKYDVFISFRGPDTRKIFVGHLYGSLSIRGIFTFKDDRRLEPGDSITDELCQAIRTSRFAVVVISKNYATSSWCLDELQLIMELVENKEIEVFPIFYEVKPSDVRHQQLLESFSLRMTEKVPGWKKALKDIANRKGMESSKFSDDATMIEEIVQNISSRLLSMLPIRFRDVVGMRAHVKVLSPLLDMDSKDDARIIGIVGTGGIGKTTIAKYLYETHKLGFSPHHYFMENVAKLCREHGLLHLQNQLLSSIFREKNVMLESVEHGRQQLEFRLRNAKVFLVFDDVDDVRQLDALAKEVQWFAPGSRIVITTRDKSLLNSCEVYDVEYLDDDKALLLFQQIAFKGGQPPSSVYSDFSSRASKLAQGLPLAVKALGSSLRGKSEMEWDKALRSFEKTPYDNIPRILNISYESLDELSKTAFLHVACLFNGELVSRVKSLLHRGEDGIRVLAEKSLIDLSTNGRIAMHHLLEKMGRRNESGNDLSLQPILWQWYDICRLADKAGTTRTEGIVLDVSERPNHIDWKVFMQMENLKYLKIYNHRRYKSLDSRTQGNPNEILQPYKLRLLQWDAYPYTTLPSSINTDCLVEVILCNSKLTTLWSGSPPRLSHLKRLNLTGSMYLKELPDLKEAVYLEELMLEGCISLTRIPESICSLPRLQKLDLSNCDGLKNLIIIVRESEATFFEGRRSLHVRSVHMDFLDAEPLAEESRDISLTNLSIKGNLKIELKVIGGYAQHFSFVSEQHIPHQVMLLEQQTARLMSHPYNFKLLHIVQVNCSEQRDPFECYSFSYFPWLMELNLINLNIEEIPDDIHHMQVLEKLNLSGNFFRGLPSSMTHLTKLKHVRLCNCRRLEALPQLYQLETLTLSDCTNLHTLVSISQAEQDHGKYNLLELRLDNCKHVETLSDQLRFFTKLTYLDISRHDFETVPTSIKDLSSLITLCLNYCMKLKSLSELPLSIKHLYSHGCMSLETFSLSVDHSVDDLDLSPCFQPNQFLSQFTRFPSGRRSEEVQLCACIQKPKILNTLDRGMRSVRTIYTERFSSETLKLMAFALCLGVLLLCKTMGNS

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
4-150 TIR
Toll-Interleukin receptor

VQNRMASDRSLKYDVFISFRGPDTRKIFVGHLYGSLSIRGIFTFKDDRRLEPGDSITDELCQAIRTSRFAVVVISKNYATSSWCLDELQLIMELVENKEIEVFPIFYEVKPSDVRHQQLLESFSLRMTEKVPGWKKALKDIANRKGM

Gene3D: G3DSA:3.40.50.10140
12-136 G3DSA:3.40.50.10140

RSLKYDVFISFRGPDTRKIFVGHLYGSLSIRGIFTFKDDRRLEPGDSITDELCQAIRTSRFAVVVISKNYATSSWCLDELQLIMELVENKEIEVFPIFYEVKPSDVRHQQLLESFSLRMTEKVPG

ProfileScan: PS50104
IPR000157
14-122 TIR
Toll-Interleukin receptor

LKYDVFISFRGPDTRKIFVGHLYGSLSIRGIFTFKDDRRLEPGDSITDELCQAIRTSRFAVVVISKNYATSSWCLDELQLIMELVENKEIEVFPIFYEVKPSDVRHQQL

HMMSmart: SM00255
IPR000157
15-147 TIR
Toll-Interleukin receptor

KYDVFISFRGPDTRKIFVGHLYGSLSIRGIFTFKDDRRLEPGDSITDELCQAIRTSRFAVVVISKNYATSSWCLDELQLIMELVENKEIEVFPIFYEVKPSDVRHQQLLESFSLRMTEKVPGWKKALKDIANR

HMMPfam: PF01582
IPR000157
18-142 TIR
Toll-Interleukin receptor

VFISFRGPDTRKIFVGHLYGSLSIRGIFTFKDDRRLEPGDSITDELCQAIRTSRFAVVVISKNYATSSWCLDELQLIMELVENKEIEVFPIFYEVKPSDVRHQQLLESFSLRMTEKVPGWKKALK

HMMPanther: PTHR11017:SF20
34-998 PTHR11017:SF20,SUBFAMILY NOT NAMED

HLYGSLSIRGIFTFKDDRRLEPGDSITDELCQAIRTSRFAVVVISKNYATSSWCLDELQLIMELVENKEIEVFPIFYEVKPSDVRHQQLLESFSLRMTEKVPGWKKALKDIANRKGMESSKFSDDATMIEEIVQNISSRLLSMLPIRFRDVVGMRAHVKVLSPLLDMDSKDDARIIGIVGTGGIGKTTIAKYLYETHKLGFSPHHYFMENVAKLCREHGLLHLQNQLLSSIFREKNVMLESVEHGRQQLEFRLRNAKVFLVFDDVDDVRQLDALAKEVQWFAPGSRIVITTRDKSLLNSCEVYDVEYLDDDKALLLFQQIAFKGGQPPSSVYSDFSSRASKLAQGLPLAVKALGSSLRGKSEMEWDKALRSFEKTPYDNIPRILNISYESLDELSKTAFLHVACLFNGELVSRVKSLLHRGEDGIRVLAEKSLIDLSTNGRIAMHHLLEKMGRRNESGNDLSLQPILWQWYDICRLADKAGTTRTEGIVLDVSERPNHIDWKVFMQMENLKYLKIYNHRRYKSLDSRTQGNPNEILQPYKLRLLQWDAYPYTTLPSSINTDCLVEVILCNSKLTTLWSGSPPRLSHLKRLNLTGSMYLKELPDLKEAVYLEELMLEGCISLTRIPESICSLPRLQKLDLSNCDGLKNLIIIVRESEATFFEGRRSLHVRSVHMDFLDAEPLAEESRDISLTNLSIKGNLKIELKVIGGYAQHFSFVSEQHIPHQVMLLEQQTARLMSHPYNFKLLHIVQVNCSEQRDPFECYSFSYFPWLMELNLINLNIEEIPDDIHHMQVLEKLNLSGNFFRGLPSSMTHLTKLKHVRLCNCRRLEALPQLYQLETLTLSDCTNLHTLVSISQAEQDHGKYNLLELRLDNCKHVETLSDQLRFFTKLTYLDISRHDFETVPTSIKDLSSLITLCLNYCMKLKSLSELPLSIKHLYSHGCMSLETFSLSVDHSVDDLDLSPCFQ

HMMPanther: PTHR11017
34-998 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

HLYGSLSIRGIFTFKDDRRLEPGDSITDELCQAIRTSRFAVVVISKNYATSSWCLDELQLIMELVENKEIEVFPIFYEVKPSDVRHQQLLESFSLRMTEKVPGWKKALKDIANRKGMESSKFSDDATMIEEIVQNISSRLLSMLPIRFRDVVGMRAHVKVLSPLLDMDSKDDARIIGIVGTGGIGKTTIAKYLYETHKLGFSPHHYFMENVAKLCREHGLLHLQNQLLSSIFREKNVMLESVEHGRQQLEFRLRNAKVFLVFDDVDDVRQLDALAKEVQWFAPGSRIVITTRDKSLLNSCEVYDVEYLDDDKALLLFQQIAFKGGQPPSSVYSDFSSRASKLAQGLPLAVKALGSSLRGKSEMEWDKALRSFEKTPYDNIPRILNISYESLDELSKTAFLHVACLFNGELVSRVKSLLHRGEDGIRVLAEKSLIDLSTNGRIAMHHLLEKMGRRNESGNDLSLQPILWQWYDICRLADKAGTTRTEGIVLDVSERPNHIDWKVFMQMENLKYLKIYNHRRYKSLDSRTQGNPNEILQPYKLRLLQWDAYPYTTLPSSINTDCLVEVILCNSKLTTLWSGSPPRLSHLKRLNLTGSMYLKELPDLKEAVYLEELMLEGCISLTRIPESICSLPRLQKLDLSNCDGLKNLIIIVRESEATFFEGRRSLHVRSVHMDFLDAEPLAEESRDISLTNLSIKGNLKIELKVIGGYAQHFSFVSEQHIPHQVMLLEQQTARLMSHPYNFKLLHIVQVNCSEQRDPFECYSFSYFPWLMELNLINLNIEEIPDDIHHMQVLEKLNLSGNFFRGLPSSMTHLTKLKHVRLCNCRRLEALPQLYQLETLTLSDCTNLHTLVSISQAEQDHGKYNLLELRLDNCKHVETLSDQLRFFTKLTYLDISRHDFETVPTSIKDLSSLITLCLNYCMKLKSLSELPLSIKHLYSHGCMSLETFSLSVDHSVDDLDLSPCFQ

superfamily: SSF52540
166-413 SSF52540

VQNISSRLLSMLPIRFRDVVGMRAHVKVLSPLLDMDSKDDARIIGIVGTGGIGKTTIAKYLYETHKLGFSPHHYFMENVAKLCREHGLLHLQNQLLSSIFREKNVMLESVEHGRQQLEFRLRNAKVFLVFDDVDDVRQLDALAKEVQWFAPGSRIVITTRDKSLLNSCEVYDVEYLDDDKALLLFQQIAFKGGQPPSSVYSDFSSRASKLAQGLPLAVKALGSSLRGKSEMEWDKALRSFEKTPYDNI

Gene3D: G3DSA:3.40.50.300
178-331 G3DSA:3.40.50.300

PIRFRDVVGMRAHVKVLSPLLDMDSKDDARIIGIVGTGGIGKTTIAKYLYETHKLGFSPHHYFMENVAKLCREHGLLHLQNQLLSSIFREKNVMLESVEHGRQQLEFRLRNAKVFLVFDDVDDVRQLDALAKEVQWFAPGSRIVITTRDKSLLN

HMMPfam: PF00931
IPR002182
193-442 NB-ARC,NBS
NB-ARC

VLSPLLDMDSKDDARIIGIVGTGGIGKTTIAKYLYETHKLGFSPHHYFMENVAKLCREHGLLHLQNQLLSSIFREKNVMLESVEHGRQQLEFRLRNAKVFLVFDDVDDVRQLDALAKEVQWFAPGSRIVITTRDKSLLNSCEVYDVEYLDDDKALLLFQQIAFKGGQPPSSVYSDFSSRASKLAQGLPLAVKALGSSLRGKSEMEWDKALRSFEKTPYDNIPRILNISYESLDELSKTAFLHVACLFNGE

FPrintScan: PR00364
IPR000767
208-223 DISEASERSIST
Disease resistance protein

IIGIVGTGGIGKTTIA

FPrintScan: PR00364
IPR000767
285-299 DISEASERSIST
Disease resistance protein

RLRNAKVFLVFDDVD

FPrintScan: PR00364
IPR000767
376-390 DISEASERSIST
Disease resistance protein

AQGLPLAVKALGSSL

superfamily: SSF46785
411-511 SSF46785

DNIPRILNISYESLDELSKTAFLHVACLFNGELVSRVKSLLHRGEDGIRVLAEKSLIDLSTNGRIAMHHLLEKMGRRNESGNDLSLQPILWQWYDICRLAD

superfamily: SSF52058
490-1022 SSF52058,LRR

SGNDLSLQPILWQWYDICRLADKAGTTRTEGIVLDVSERPNHIDWKVFMQMENLKYLKIYNHRRYKSLDSRTQGNPNEILQPYKLRLLQWDAYPYTTLPSSINTDCLVEVILCNSKLTTLWSGSPPRLSHLKRLNLTGSMYLKELPDLKEAVYLEELMLEGCISLTRIPESICSLPRLQKLDLSNCDGLKNLIIIVRESEATFFEGRRSLHVRSVHMDFLDAEPLAEESRDISLTNLSIKGNLKIELKVIGGYAQHFSFVSEQHIPHQVMLLEQQTARLMSHPYNFKLLHIVQVNCSEQRDPFECYSFSYFPWLMELNLINLNIEEIPDDIHHMQVLEKLNLSGNFFRGLPSSMTHLTKLKHVRLCNCRRLEALPQLYQLETLTLSDCTNLHTLVSISQAEQDHGKYNLLELRLDNCKHVETLSDQLRFFTKLTYLDISRHDFETVPTSIKDLSSLITLCLNYCMKLKSLSELPLSIKHLYSHGCMSLETFSLSVDHSVDDLDLSPCFQPNQFLSQFTRFPSGRRSEEVQLCA

Gene3D: G3DSA:3.80.10.10
531-676 G3DSA:3.80.10.10

HIDWKVFMQMENLKYLKIYNHRRYKSLDSRTQGNPNEILQPYKLRLLQWDAYPYTTLPSSINTDCLVEVILCNSKLTTLWSGSPPRLSHLKRLNLTGSMYLKELPDLKEAVYLEELMLEGCISLTRIPESICSLPRLQKLDLSNCD

FPrintScan: PR00364
IPR000767
662-678 DISEASERSIST
Disease resistance protein

CSLPRLQKLDLSNCDGL

Gene3D: G3DSA:3.80.10.10
796-984 G3DSA:3.80.10.10

SFSYFPWLMELNLINLNIEEIPDDIHHMQVLEKLNLSGNFFRGLPSSMTHLTKLKHVRLCNCRRLEALPQLYQLETLTLSDCTNLHTLVSISQAEQDHGKYNLLELRLDNCKHVETLSDQLRFFTKLTYLDISRHDFETVPTSIKDLSSLITLCLNYCMKLKSLSELPLSIKHLYSHGCMSLETFSLSV


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox