PRGDB00061789 (Putative disease resistance protein)

From PRG Wiki
Revision as of 14:33, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Putative disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 19033428 (AC113335)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Genomic sequence for Oryza sativa (japonica cultivar-group) cultivar Nipponbare clone OJ1003C07, from chromosome 10, complete sequence.

DNA Sequence

GTTCTTTGTTGTAATTGACGACATGCAGAGGGAATATTGGAACAGCTCTTTCAGAAATGCCTTTCCTTCTGATACGGGACTGAGCAGCATTGTGATCGTAACGACGGCCATCCAGTCCATAGCAAATGCCTGCAGCTCTCGCAACAGCCATGTGTACGTGATGAGAACCCTGAATGAGGAACACTCAAGACAGCTATTCTTGAAAGAAGCATCATGGAAAGATTACCCACCAGGTTCAGAAGCAATCCTGAAGAAATGTGATGGTCTGCCGCTTGCTCTCGTCACAACAGCCCAATTCTTGCAAAGCAGATGTCAGCAGCAGCCTCTGGGATGCGCAAAGCTGTGCGACAACCTGGGTAAGCATCTTGTGACAGAAGACACCTTAGCAAGAATGAAGCGTGTGCTTGTTCACCATTACAGCAGCCTCCCTGGCCATGTCATCAAGGCCTGCTTGCTCTACCTGGGAATTTTCCCCAGTGGTCATCCTGTCAGGAGAAAAACTCTGATAAGGAGATGGTCAGCTGAAGGATTCGTGGGAGCAGACCATCACCGGAGCTCTCTAGATGTCGCCATCGACAGCTTCGAGGAGCTCGTTAACCGGAGCATCATCCAGCCTGTTGATGTGAGCAGCAACACTGAGGTGAAGACCTGCCAAACTCACGGTATGATGCTTGAGTTCATCCTGCACAAATCCATATGTGACAACTTCATCACATTTCTGTACGGTCAGGCTCGCCTGCCTGACAAGATCCGTTGCGTTTCCATACAACAGAACAGTGGTAGTAAGACCAGAGTGGATTCAGACATTGATCTGTCCCTTGTCCGGTCTCTGACGATCTTCGGAAAAGCGCACAAGTCTTTCCTGAATTTCTCCAGGTATAAACTTCTCCGGGTTTTGGATCTCGAAGAGTGTGATGAATTGGAGGACGAGCATCTGAAGAAGATATGCAAGCGGTTGCTTCTCAAGTACCTAAGCCTCGGCCGTGGAATTACAGTGCTTCCAAAGGAGATCGCAAAGCTGAAATTTCTTGAGACGCTCGATTTACGGCGAACGGTGATTAAGTTTCTTCCCATACAAGTGCTCGAGCTGCCATGTCTGATTCATCTGTTTGGAGTGTTCAAGATCCAAGATGCTGACCAGCAAATGAGGAAGCTCAAATCCTTCCTGACGGAGAAAAGCAAGTTGGAGACACTGGCCGGATTTGTCACCGATAGGTGCCAAACATTTCCTCAGCTCATGAAACATATGACCAACTTGGCAAAGGTGAAAATATGGTGCGAGAACACCGCAGATGCCAGCAGCAGCAGCAACTCTGATGTTCACCTGTCAGAGGCCATTCAGGAGTTCATCCAGAGAGGCACAGATGTGAACGATGTCCGATCACTCTCTCTCGATGTCGGCGAATGCTCCCAAGAATTTCTCAACTTCTCTTTAGGAGATTCATGCTACCTAAGCTCCCTGAAGCTGAAAGGAAACAAGATATGCAGGTTGCCACCGTTCGTCACCTCGCTGGCCGTTCTCACTGATCTGTGCCTCTCATCCTCTGATCGCCTCAGCTCTGATGTTCTTGCGGCCCTGAGCAACGTCCGCGCGCTGCGTTACCTGAAGCTGATCGCGCGTCACCTGGACAGGTTCGTGATCGAACGCGGCGATCTGCAGAGCCTGCGACGCCTGCACATCGTGGTGGTGTCCATGACGACGATGAGCAAGCAGCAGCCAGAGATCCAGGAGGGAGCCCTGCCGAATCTGGAGTCGTTCCATCTCCTCTGCAAGGATCTGGATGGCCCCTGCGGCCATGGAGGCATCAGGATCGACTCCCTCGGGCTCGGGTGCCTCAGGGAGATTGTTCTTGACGACGGAGTTCGTGAGACGGCGAAGGAGCAGTGGAAGGACGCGGCGAGGCGGCACCCGAAGCGGCCCAAGGTGGTGTTCGTCGGAGCGGGAGACGTCGTCGATCGGCGGCGGGTGGGTGCTGCTGCTGCTGCCGCGCCTGCAGCAGGAGAGAGCAATTCTGCGATGGCACCGGCGGCGGTGGCTTCGGTGGTGGCCGCCGGCGACGTCAAGAGGCCGGCTAGGGAGGAATCCGATATCTCCGCCGCGCTGGCGAGCCTTCCGGCGAAGATGGCGAGGCTGCTCGGCGCTGCGAGCATCCACCAGAGTAGTGGGACTCAGGGCGAGCTGTCCTGCGGCGGGAACGGAGCATCACAGCGCCATTTCAGCTAGATGGAGACCGCGGTGCTGAGCGCCGTGCTCAGAACGCTGGGGCCGAAGCTCTACGCGTTCCTCCGTGACGGGCACGACCTGTTGCGGCGGGACCTGGAGCGCGACGTCCACTACATCCGGAACGAGCTCGCCATGATCGCCGCCGCGATCGAGGAGCACGACCGCCGCCCGCCGCCCGCCGCAGGCGACGTGCGGAGCGCCTGGATCCGCGGCGTGCGCGACCTGGCCTGCGACATGGAGGACTGCGTCGACCGCTTCGTGCACCGCGCCACCGGCCACGGCCTGGCCTCCATGGGCGCCCGCGCCAAGTTCGCCGCCGTGATCCAGGAGCTCAGGAGGAAATCCGAGGAGCTGTCCCGCCTCAGAGCCAGTTACGCCGCCGCCGCCGGCGAGCCCAGCTGCTGGGTGGCTACAGGATCATCCGCGTTGACCCTGCCGGCGTCGTCGTCTGAGGCGCACACCCTTGCATCTGACATCGTGGGGATGGACGGGCCCCGGGACGAGATTCTTGAGCTGATAGGGGAAACCCAGGGCCAGCTCAAGGTGATCTCCATTGTTGGGTTTGGTGGGTTAGGGAAGACGCTTCTTGCCAGGCAAATCTACGAGAGCGACGCCGTCGCCGCGCAATTCCATCCACGGATTTGGGTTCGTGCCGCGGGGAAGAACGCAGAGGATGTCCTCATGGACATTCTCCAGCAGCTGGGGATGCCGGTACATCACTGCCATGCCAGCAATCTCGTTGTAAATCTCAGAAATTGCCTTGAATCCAAGAG


Protein sequences

Name Description Sequence
Putative disease resistance protein Putative disease resistance protein [Oryza sativa Japonica Group].

METAVLSAVLRTLGPKLYAFLRDGHDLLRRDLERDVHYIRNELAMIAAAIEEHDRRPPPAAGDVRSAWIRGVRDLACDMEDCVDRFVHRATGHGLASMGARAKFAAVIQELRRKSEELSRLRASYAAAAGEPSCWVATGSSALTLPASSSEAHTLASDIVGMDGPRDEILELIGETQGQLKVISIVGFGGLGKTLLARQIYESDAVAAQFHPRIWVRAAGKNAEDVLMDILQQLGMPVHHCHASNLVVNLRNCLESKRFFVVIDDMQREYWNSSFRNAFPSDTGLSSIVIVTTAIQSIANACSSRNSHVYVMRTLNEEHSRQLFLKEASWKDYPPGSEAILKKCDGLPLALVTTAQFLQSRCQQQPLGCAKLCDNLGKHLVTEDTLARMKRVLVHHYSSLPGHVIKACLLYLGIFPSGHPVRRKTLIRRWSAEGFVGADHHRSSLDVAIDSFEELVNRSIIQPVDVSSNTEVKTCQTHGMMLEFILHKSICDNFITFLYGQARLPDKIRCVSIQQNSGSKTRVDSDIDLSLVRSLTIFGKAHKSFLNFSRYKLLRVLDLEECDELEDEHLKKICKRLLLKYLSLGRGITVLPKEIAKLKFLETLDLRRTVIKFLPIQVLELPCLIHLFGVFKIQDADQQMRKLKSFLTEKSKLETLAGFVTDRCQTFPQLMKHMTNLAKVKIWCENTADASSSSNSDVHLSEAIQEFIQRGTDVNDVRSLSLDVGECSQEFLNFSLGDSCYLSSLKLKGNKICRLPPFVTSLAVLTDLCLSSSDRLSSDVLAALSNVRALRYLKLIARHLDRFVIERGDLQSLRRLHIVVVSMTTMSKQQPEIQEGALPNLESFHLLCKDLDGPCGHGGIRIDSLGLGCLREIVLDDGVRETAKEQWKDAARRHPKRPKVVFVGAGDVVDRRRVGAAAAAAPAAGESNSAMAPAAVASVVAAGDVKRPAREESDISAALASLPAKMARLLGAASIHQSSGTQGELSCGGNGASQRHFS

Putative disease resistance protein Putative disease resistance protein [Oryza sativa Japonica Group].

METAVLSAVLRTLGPKLYAFLRDGHDLLRRDLERDVHYIRNELAMIAAAIEEHDRRPPPAAGDVRSAWIRGVRDLACDMEDCVDRFVHRATGHGLASMGARAKFAAVIQELRRKSEELSRLRASYAAAAGEPSCWVATGSSALTLPASSSEAHTLASDIVGMDGPRDEILELIGETQGQLKVISIVGFGGLGKTLLARQIYESDAVAAQFHPRIWVRAAGKNAEDVLMDILQQLGMPVHHCHASNLVVNLRNCLESKRFFVVIDDMQREYWNSSFRNAFPSDTGLSSIVIVTTAIQSIANACSSRNSHVYVMRTLNEEHSRQLFLKEASWKDYPPGSEAILKKCDGLPLALVTTAQFLQSRCQQQPLGCAKLCDNLGKHLVTEDTLARMKRVLVHHYSSLPGHVIKACLLYLGIFPSGHPVRRKTLIRRWSAEGFVGADHHRSSLDVAIDSFEELVNRSIIQPVDVSSNTEVKTCQTHGMMLEFILHKSICDNFITFLYGQARLPDKIRCVSIQQNSGSKTRVDSDIDLSLVRSLTIFGKAHKSFLNFSRYKLLRVLDLEECDELEDEHLKKICKRLLLKYLSLGRGITVLPKEIAKLKFLETLDLRRTVIKFLPIQVLELPCLIHLFGVFKIQDADQQMRKLKSFLTEKSKLETLAGFVTDRCQTFPQLMKHMTNLAKVKIWCENTADASSSSNSDVHLSEAIQEFIQRGTDVNDVRSLSLDVGECSQEFLNFSLGDSCYLSSLKLKGNKICRLPPFVTSLAVLTDLCLSSSDRLSSDVLAALSNVRALRYLKLIARHLDRFVIERGDLQSLRRLHIVVVSMTTMSKQQPEIQEGALPNLESFHLLCKDLDGPCGHGGIRIDSLGLGCLREIVLDDGVRETAKEQWKDAARRHPKRPKVVFVGAGDVVDRRRVGAAAAAAPAAGESNSAMAPAAVASVVAAGDVKRPAREESDISAALASLPAKMARLLGAASIHQSSGTQGELSCGGNGASQRHFS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
6-926 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LSAVLRTLGPKLYAFLRDGHDLLRRDLERDVHYIRNELAMIAAAIEEHDRRPPPAAGDVRSAWIRGVRDLACDMEDCVDRFVHRATGHGLASMGARAKFAAVIQELRRKSEELSRLRASYAAAAGEPSCWVATGSSALTLPASSSEAHTLASDIVGMDGPRDEILELIGETQGQLKVISIVGFGGLGKTLLARQIYESDAVAAQFHPRIWVRAAGKNAEDVLMDILQQLGMPVHHCHASNLVVNLRNCLESKRFFVVIDDMQREYWNSSFRNAFPSDTGLSSIVIVTTAIQSIANACSSRNSHVYVMRTLNEEHSRQLFLKEASWKDYPPGSEAILKKCDGLPLALVTTAQFLQSRCQQQPLGCAKLCDNLGKHLVTEDTLARMKRVLVHHYSSLPGHVIKACLLYLGIFPSGHPVRRKTLIRRWSAEGFVGADHHRSSLDVAIDSFEELVNRSIIQPVDVSSNTEVKTCQTHGMMLEFILHKSICDNFITFLYGQARLPDKIRCVSIQQNSGSKTRVDSDIDLSLVRSLTIFGKAHKSFLNFSRYKLLRVLDLEECDELEDEHLKKICKRLLLKYLSLGRGITVLPKEIAKLKFLETLDLRRTVIKFLPIQVLELPCLIHLFGVFKIQDADQQMRKLKSFLTEKSKLETLAGFVTDRCQTFPQLMKHMTNLAKVKIWCENTADASSSSNSDVHLSEAIQEFIQRGTDVNDVRSLSLDVGECSQEFLNFSLGDSCYLSSLKLKGNKICRLPPFVTSLAVLTDLCLSSSDRLSSDVLAALSNVRALRYLKLIARHLDRFVIERGDLQSLRRLHIVVVSMTTMSKQQPEIQEGALPNLESFHLLCKDLDGPCGHGGIRIDSLGLGCLREIVLDDGVRETAKEQWKDAARRHPKRPKVVFVGAGDVVDRRRVGAAAAAAPAAGE

HMMPanther: PTHR23155:SF268
6-926 PTHR23155:SF268,SUBFAMILY NOT NAMED

LSAVLRTLGPKLYAFLRDGHDLLRRDLERDVHYIRNELAMIAAAIEEHDRRPPPAAGDVRSAWIRGVRDLACDMEDCVDRFVHRATGHGLASMGARAKFAAVIQELRRKSEELSRLRASYAAAAGEPSCWVATGSSALTLPASSSEAHTLASDIVGMDGPRDEILELIGETQGQLKVISIVGFGGLGKTLLARQIYESDAVAAQFHPRIWVRAAGKNAEDVLMDILQQLGMPVHHCHASNLVVNLRNCLESKRFFVVIDDMQREYWNSSFRNAFPSDTGLSSIVIVTTAIQSIANACSSRNSHVYVMRTLNEEHSRQLFLKEASWKDYPPGSEAILKKCDGLPLALVTTAQFLQSRCQQQPLGCAKLCDNLGKHLVTEDTLARMKRVLVHHYSSLPGHVIKACLLYLGIFPSGHPVRRKTLIRRWSAEGFVGADHHRSSLDVAIDSFEELVNRSIIQPVDVSSNTEVKTCQTHGMMLEFILHKSICDNFITFLYGQARLPDKIRCVSIQQNSGSKTRVDSDIDLSLVRSLTIFGKAHKSFLNFSRYKLLRVLDLEECDELEDEHLKKICKRLLLKYLSLGRGITVLPKEIAKLKFLETLDLRRTVIKFLPIQVLELPCLIHLFGVFKIQDADQQMRKLKSFLTEKSKLETLAGFVTDRCQTFPQLMKHMTNLAKVKIWCENTADASSSSNSDVHLSEAIQEFIQRGTDVNDVRSLSLDVGECSQEFLNFSLGDSCYLSSLKLKGNKICRLPPFVTSLAVLTDLCLSSSDRLSSDVLAALSNVRALRYLKLIARHLDRFVIERGDLQSLRRLHIVVVSMTTMSKQQPEIQEGALPNLESFHLLCKDLDGPCGHGGIRIDSLGLGCLREIVLDDGVRETAKEQWKDAARRHPKRPKVVFVGAGDVVDRRRVGAAAAAAPAAGE

HMMPanther: PTHR23155
6-926 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LSAVLRTLGPKLYAFLRDGHDLLRRDLERDVHYIRNELAMIAAAIEEHDRRPPPAAGDVRSAWIRGVRDLACDMEDCVDRFVHRATGHGLASMGARAKFAAVIQELRRKSEELSRLRASYAAAAGEPSCWVATGSSALTLPASSSEAHTLASDIVGMDGPRDEILELIGETQGQLKVISIVGFGGLGKTLLARQIYESDAVAAQFHPRIWVRAAGKNAEDVLMDILQQLGMPVHHCHASNLVVNLRNCLESKRFFVVIDDMQREYWNSSFRNAFPSDTGLSSIVIVTTAIQSIANACSSRNSHVYVMRTLNEEHSRQLFLKEASWKDYPPGSEAILKKCDGLPLALVTTAQFLQSRCQQQPLGCAKLCDNLGKHLVTEDTLARMKRVLVHHYSSLPGHVIKACLLYLGIFPSGHPVRRKTLIRRWSAEGFVGADHHRSSLDVAIDSFEELVNRSIIQPVDVSSNTEVKTCQTHGMMLEFILHKSICDNFITFLYGQARLPDKIRCVSIQQNSGSKTRVDSDIDLSLVRSLTIFGKAHKSFLNFSRYKLLRVLDLEECDELEDEHLKKICKRLLLKYLSLGRGITVLPKEIAKLKFLETLDLRRTVIKFLPIQVLELPCLIHLFGVFKIQDADQQMRKLKSFLTEKSKLETLAGFVTDRCQTFPQLMKHMTNLAKVKIWCENTADASSSSNSDVHLSEAIQEFIQRGTDVNDVRSLSLDVGECSQEFLNFSLGDSCYLSSLKLKGNKICRLPPFVTSLAVLTDLCLSSSDRLSSDVLAALSNVRALRYLKLIARHLDRFVIERGDLQSLRRLHIVVVSMTTMSKQQPEIQEGALPNLESFHLLCKDLDGPCGHGGIRIDSLGLGCLREIVLDDGVRETAKEQWKDAARRHPKRPKVVFVGAGDVVDRRRVGAAAAAAPAAGE

HMMPanther: PTHR23155:SF268
6-926 PTHR23155:SF268,SUBFAMILY NOT NAMED

LSAVLRTLGPKLYAFLRDGHDLLRRDLERDVHYIRNELAMIAAAIEEHDRRPPPAAGDVRSAWIRGVRDLACDMEDCVDRFVHRATGHGLASMGARAKFAAVIQELRRKSEELSRLRASYAAAAGEPSCWVATGSSALTLPASSSEAHTLASDIVGMDGPRDEILELIGETQGQLKVISIVGFGGLGKTLLARQIYESDAVAAQFHPRIWVRAAGKNAEDVLMDILQQLGMPVHHCHASNLVVNLRNCLESKRFFVVIDDMQREYWNSSFRNAFPSDTGLSSIVIVTTAIQSIANACSSRNSHVYVMRTLNEEHSRQLFLKEASWKDYPPGSEAILKKCDGLPLALVTTAQFLQSRCQQQPLGCAKLCDNLGKHLVTEDTLARMKRVLVHHYSSLPGHVIKACLLYLGIFPSGHPVRRKTLIRRWSAEGFVGADHHRSSLDVAIDSFEELVNRSIIQPVDVSSNTEVKTCQTHGMMLEFILHKSICDNFITFLYGQARLPDKIRCVSIQQNSGSKTRVDSDIDLSLVRSLTIFGKAHKSFLNFSRYKLLRVLDLEECDELEDEHLKKICKRLLLKYLSLGRGITVLPKEIAKLKFLETLDLRRTVIKFLPIQVLELPCLIHLFGVFKIQDADQQMRKLKSFLTEKSKLETLAGFVTDRCQTFPQLMKHMTNLAKVKIWCENTADASSSSNSDVHLSEAIQEFIQRGTDVNDVRSLSLDVGECSQEFLNFSLGDSCYLSSLKLKGNKICRLPPFVTSLAVLTDLCLSSSDRLSSDVLAALSNVRALRYLKLIARHLDRFVIERGDLQSLRRLHIVVVSMTTMSKQQPEIQEGALPNLESFHLLCKDLDGPCGHGGIRIDSLGLGCLREIVLDDGVRETAKEQWKDAARRHPKRPKVVFVGAGDVVDRRRVGAAAAAAPAAGE

superfamily: SSF52540
142-360 SSF52540

ALTLPASSSEAHTLASDIVGMDGPRDEILELIGETQGQLKVISIVGFGGLGKTLLARQIYESDAVAAQFHPRIWVRAAGKNAEDVLMDILQQLGMPVHHCHASNLVVNLRNCLESKRFFVVIDDMQREYWNSSFRNAFPSDTGLSSIVIVTTAIQSIANACSSRNSHVYVMRTLNEEHSRQLFLKEASWKDYPPGSEAILKKCDGLPLALVTTAQFLQS

superfamily: SSF52540
142-360 SSF52540

ALTLPASSSEAHTLASDIVGMDGPRDEILELIGETQGQLKVISIVGFGGLGKTLLARQIYESDAVAAQFHPRIWVRAAGKNAEDVLMDILQQLGMPVHHCHASNLVVNLRNCLESKRFFVVIDDMQREYWNSSFRNAFPSDTGLSSIVIVTTAIQSIANACSSRNSHVYVMRTLNEEHSRQLFLKEASWKDYPPGSEAILKKCDGLPLALVTTAQFLQS

Gene3D: G3DSA:3.40.50.300
163-267 G3DSA:3.40.50.300

DGPRDEILELIGETQGQLKVISIVGFGGLGKTLLARQIYESDAVAAQFHPRIWVRAAGKNAEDVLMDILQQLGMPVHHCHASNLVVNLRNCLESKRFFVVIDDMQ

Gene3D: G3DSA:3.40.50.300
163-267 G3DSA:3.40.50.300

DGPRDEILELIGETQGQLKVISIVGFGGLGKTLLARQIYESDAVAAQFHPRIWVRAAGKNAEDVLMDILQQLGMPVHHCHASNLVVNLRNCLESKRFFVVIDDMQ

HMMPfam: PF00931
IPR002182
168-440 NB-ARC,NBS
NB-ARC

EILELIGETQGQLKVISIVGFGGLGKTLLARQIYESDAVAAQFHPRIWVRAAGKNAEDVLMDILQQLGMPVHHCHASNLVVNLRNCLESKRFFVVIDDMQREYWNSSFRNAFPSDTGLSSIVIVTTAIQSIANACSSRNSHVYVMRTLNEEHSRQLFLKEASWKDYPPGSEAILKKCDGLPLALVTTAQFLQSRCQQQPLGCAKLCDNLGKHLVTEDTLARMKRVLVHHYSSLPGHVIKACLLYLGIFPSGHPVRRKTLIRRWSAEGFVGADH

HMMPfam: PF00931
IPR002182
168-440 NB-ARC,NBS
NB-ARC

EILELIGETQGQLKVISIVGFGGLGKTLLARQIYESDAVAAQFHPRIWVRAAGKNAEDVLMDILQQLGMPVHHCHASNLVVNLRNCLESKRFFVVIDDMQREYWNSSFRNAFPSDTGLSSIVIVTTAIQSIANACSSRNSHVYVMRTLNEEHSRQLFLKEASWKDYPPGSEAILKKCDGLPLALVTTAQFLQSRCQQQPLGCAKLCDNLGKHLVTEDTLARMKRVLVHHYSSLPGHVIKACLLYLGIFPSGHPVRRKTLIRRWSAEGFVGADH

FPrintScan: PR00364
IPR000767
182-197 DISEASERSIST
Disease resistance protein

VISIVGFGGLGKTLLA

FPrintScan: PR00364
IPR000767
182-197 DISEASERSIST
Disease resistance protein

VISIVGFGGLGKTLLA

FPrintScan: PR00364
IPR000767
253-267 DISEASERSIST
Disease resistance protein

CLESKRFFVVIDDMQ

FPrintScan: PR00364
IPR000767
253-267 DISEASERSIST
Disease resistance protein

CLESKRFFVVIDDMQ

FPrintScan: PR00364
IPR000767
344-358 DISEASERSIST
Disease resistance protein

CDGLPLALVTTAQFL

FPrintScan: PR00364
IPR000767
344-358 DISEASERSIST
Disease resistance protein

CDGLPLALVTTAQFL

superfamily: SSF52058
485-848 SSF52058,LRR

ILHKSICDNFITFLYGQARLPDKIRCVSIQQNSGSKTRVDSDIDLSLVRSLTIFGKAHKSFLNFSRYKLLRVLDLEECDELEDEHLKKICKRLLLKYLSLGRGITVLPKEIAKLKFLETLDLRRTVIKFLPIQVLELPCLIHLFGVFKIQDADQQMRKLKSFLTEKSKLETLAGFVTDRCQTFPQLMKHMTNLAKVKIWCENTADASSSSNSDVHLSEAIQEFIQRGTDVNDVRSLSLDVGECSQEFLNFSLGDSCYLSSLKLKGNKICRLPPFVTSLAVLTDLCLSSSDRLSSDVLAALSNVRALRYLKLIARHLDRFVIERGDLQSLRRLHIVVVSMTTMSKQQPEIQEGALPNLESFHLLC

superfamily: SSF52058
485-848 SSF52058,LRR

ILHKSICDNFITFLYGQARLPDKIRCVSIQQNSGSKTRVDSDIDLSLVRSLTIFGKAHKSFLNFSRYKLLRVLDLEECDELEDEHLKKICKRLLLKYLSLGRGITVLPKEIAKLKFLETLDLRRTVIKFLPIQVLELPCLIHLFGVFKIQDADQQMRKLKSFLTEKSKLETLAGFVTDRCQTFPQLMKHMTNLAKVKIWCENTADASSSSNSDVHLSEAIQEFIQRGTDVNDVRSLSLDVGECSQEFLNFSLGDSCYLSSLKLKGNKICRLPPFVTSLAVLTDLCLSSSDRLSSDVLAALSNVRALRYLKLIARHLDRFVIERGDLQSLRRLHIVVVSMTTMSKQQPEIQEGALPNLESFHLLC

Gene3D: G3DSA:3.80.10.10
523-657 G3DSA:3.80.10.10

VDSDIDLSLVRSLTIFGKAHKSFLNFSRYKLLRVLDLEECDELEDEHLKKICKRLLLKYLSLGRGITVLPKEIAKLKFLETLDLRRTVIKFLPIQVLELPCLIHLFGVFKIQDADQQMRKLKSFLTEKSKLETLA

Gene3D: G3DSA:3.80.10.10
523-657 G3DSA:3.80.10.10

VDSDIDLSLVRSLTIFGKAHKSFLNFSRYKLLRVLDLEECDELEDEHLKKICKRLLLKYLSLGRGITVLPKEIAKLKFLETLDLRRTVIKFLPIQVLELPCLIHLFGVFKIQDADQQMRKLKSFLTEKSKLETLA

FPrintScan: PR00364
IPR000767
549-565 DISEASERSIST
Disease resistance protein

SRYKLLRVLDLEECDEL

FPrintScan: PR00364
IPR000767
549-565 DISEASERSIST
Disease resistance protein

SRYKLLRVLDLEECDEL

Gene3D: G3DSA:3.80.10.10
733-847 G3DSA:3.80.10.10

NFSLGDSCYLSSLKLKGNKICRLPPFVTSLAVLTDLCLSSSDRLSSDVLAALSNVRALRYLKLIARHLDRFVIERGDLQSLRRLHIVVVSMTTMSKQQPEIQEGALPNLESFHLL

Gene3D: G3DSA:3.80.10.10
733-847 G3DSA:3.80.10.10

NFSLGDSCYLSSLKLKGNKICRLPPFVTSLAVLTDLCLSSSDRLSSDVLAALSNVRALRYLKLIARHLDRFVIERGDLQSLRRLHIVVVSMTTMSKQQPEIQEGALPNLESFHLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox