PRGDB00061792 (Putative disease resistance protein RPM1)

From PRG Wiki
Revision as of 14:33, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Putative disease resistance protein RPM1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 15426056 (AC079843)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group chromosome 10 clone OSJNBa0013J21, complete sequence.

DNA Sequence

ATGGATGCCGTGGTGAGTGTCTCACATGGGGCACTGGGGCCGCTACTGGGCAAGCTCAGTACCTTGCTCGCAGACAAGTACGCGTGCTTGAAAGGTGTCCGCCGTGAGATCCATTCCCTAAGATCGGAGCTGAGCAACATGCAAGCGGCGCTCCACAAGTATGCGTCACTCGAGGACCCTGACATCCAGGTGAAGGCCTGGATCACCGAGCTGAGGGAGCTTGCCTATGACATCGAGGACTGCATAGACAAGTTTATGCACCAACTTGGTGCCAACGGTGAGCAGCACCGCACCAGTAATAGCATCGAGGACTTCTTTAGGAAGAGTATACAACGTCTCAAAACTCTTGGCCCGAGGCATAATATTGCTGGCGAGATTGAGGAACTGAAGGCACGAGTTATCTCGGTGAGAGATCAAAAGAACAGCTACAAGCTTGACGATATTTTTTGCAGTAGCTCTAGCAATACCAATGCTTCTGTTGATCCACGGTTGGCTACTCTCTTCGCGGAAGAGAACCATCTTGTCGGTATAGATGGCCCAAGGGTTGAACTTGTCAATTGGTTGGATGCAGAGAGCAGGTTGATAAAGTGTCGCAAGGTATTATCTATTGTGGGGTTTGGAGGTCTTGGGAAGACAACTCTAGCGAATGAGGTATATCGTAGGGTTAAAGTTCATTTTGACTGCCATGCATTTGTGTCAGTGTCACAAAAGCCCGATTTCAAGAATATCTTCAAGGATATAACATACAATATGCCTACGAAAGATGGTTTCCTCAAAGATATTGACACATGGAATGAAAAGAAATTTATTGAAAAGCTAAGAGAACTACTTGTGGATAAGAGGTATCTTGTTATAATTGATGATGTATGGTCTATTTCGGCATGGAAAGCTATCACGGTTGCATTCCCGGATAATGACTGTTCCAGTACAATTATAGTTACTACACGCGTTTCCGATGTTGGATGGTCATGCTGCTTAAATGGCATTGACCGCAATTATCAGATGGAACCTCTAAGTGAAGTTCACTCTGGAAGACTATTTTGCAAGAGAATTTTCAGTACAAATGAGGATGGCTGCCCAGATATTTTACAGGAAGTTTCAACAGATATATTGAAGAAATGTGGCGGTCTTCCATTAGCAATTATTAGCATATCTGGCTTATTAGCAAATAGACCAGTTATCAAGGAAGAGTGGGAGAAAGTGAAAGAATCGATTGGTTTTGCATTGGACAAGAACCAAAATCTAGAAGGAATGAAAATCATACTGTCCCTTAGCTTTAATAACCTTCCAAACTATCTCAAGACTTGTTTGCTATATTTGAGCATATTTCCAGAGGATTGTATTATTGAAAGAAACATGGTAGTATGGCGATGGATAGCTGAAGGCTTTATCTCTGAAGACTGTGGGCAGAAATTGGAAGATGTTGCGGAGAGCTACTTTTATGAGCTCATCAACAAAAGTCTGGTTCAACCTGTGGACATTGGTTTTGATGGTTTAGAGCAGTATTTGGAAAATATAGACAAGCTATTCCAGCTTGAGTACTTAAGCCTTTGTTGTTCAAACATATCACATATACCAACACAAATTGCAAAGCTCCAAAATTTGGTGACGCTGGACCTTCGCCAAACATGCGTAGAAGAGTTTCCCACTGAATTTTGCCGATTGATAAAGCTACAACATCTTCTCGGAGATCGGATGTTGAAGCTACCGGATGGAATTGGGAATATGAGGAATCTACAGGTGCTATCAGGCATTAATATAAGCAGTAGCTCAGCGAGCGCAGTGGCAGAACTTGGTGAGCTGACCAGTTTGAGGGACCTCAAAATAAGTTTGTCTGATAAACTCAGCAAGTGCAAGACAAAAGAAGAGATGTTACTCGCCTCACTTTGTAAACTAAGCAGCTACAAACTCCAATCATTGCACATTATAGATCACAGTACCGATGATTTCTTAGAACGTTGGTTCCCTATCCCTTGTTTCCTCCGATTGTTTCACATGATCACTGACTACTATCTCCTGCAACTTCCAAAGTGGGTTAAACCGTATCTCACCAAAATGGCATACCTTAGCATAAATTTACGTGAGATAAAGAAGGAAGATATGGAAACACTTGGAGACCTGCCAGCCTTACTCAGTCTAGAAATATGGCTGGAACCTGACCCAAAAGAACAGCTTACAGTCCAAAGCACAGGATTCCTATTTCTTAAGGAGTTTGTCCTTGCTTGTAGCGATCACAATGGTGGAGCATACCTTACGTTTGAGAAAGGAGCTATGCCAAAGCTGGAGAAGCTTGAGATTCTATTTCACGTTTTAATGGCAGAACCCCATGATTTCTATTTTGGCATCAACAACCTCCAACATCTCAAAGAAGTGGAGGTATTTATCTACCGTGTGGGCGCTGAAGATTCTGATGCTGAGGCTGCGGTGGCTGCCATCAGGAGCGAAGCAAATGCAAATCCCAACCATCCTAGACTTGCCATCAAGGAAGCATACGTCGAAGAGATCAGTAACAAAGAGTGTGATGATAACAAGGATGCAGAGGATCAGCAAGGCGGTGTTACTGTCAACTAA


Protein sequences

Name Description Sequence
Putative disease resistance protein RPM1 Putative disease resistance protein RPM1 [Oryza sativa Japonica Group].

MDAVVSVSHGALGPLLGKLSTLLADKYACLKGVRREIHSLRSELSNMQAALHKYASLEDPDIQVKAWITELRELAYDIEDCIDKFMHQLGANGEQHRTSNSIEDFFRKSIQRLKTLGPRHNIAGEIEELKARVISVRDQKNSYKLDDIFCSSSSNTNASVDPRLATLFAEENHLVGIDGPRVELVNWLDAESRLIKCRKVLSIVGFGGLGKTTLANEVYRRVKVHFDCHAFVSVSQKPDFKNIFKDITYNMPTKDGFLKDIDTWNEKKFIEKLRELLVDKRYLVIIDDVWSISAWKAITVAFPDNDCSSTIIVTTRVSDVGWSCCLNGIDRNYQMEPLSEVHSGRLFCKRIFSTNEDGCPDILQEVSTDILKKCGGLPLAIISISGLLANRPVIKEEWEKVKESIGFALDKNQNLEGMKIILSLSFNNLPNYLKTCLLYLSIFPEDCIIERNMVVWRWIAEGFISEDCGQKLEDVAESYFYELINKSLVQPVDIGFDGLEQYLENIDKLFQLEYLSLCCSNISHIPTQIAKLQNLVTLDLRQTCVEEFPTEFCRLIKLQHLLGDRMLKLPDGIGNMRNLQVLSGINISSSSASAVAELGELTSLRDLKISLSDKLSKCKTKEEMLLASLCKLSSYKLQSLHIIDHSTDDFLERWFPIPCFLRLFHMITDYYLLQLPKWVKPYLTKMAYLSINLREIKKEDMETLGDLPALLSLEIWLEPDPKEQLTVQSTGFLFLKEFVLACSDHNGGAYLTFEKGAMPKLEKLEILFHVLMAEPHDFYFGINNLQHLKEVEVFIYRVGAEDSDAEAAVAAIRSEANANPNHPRLAIKEAYVEEISNKECDDNKDAEDQQGGVTVN

Putative disease resistance protein RPM1 Putative disease resistance protein RPM1 [Oryza sativa Japonica Group].

MDAVVSVSHGALGPLLGKLSTLLADKYACLKGVRREIHSLRSELSNMQAALHKYASLEDPDIQVKAWITELRELAYDIEDCIDKFMHQLGANGEQHRTSNSIEDFFRKSIQRLKTLGPRHNIAGEIEELKARVISVRDQKNSYKLDDIFCSSSSNTNASVDPRLATLFAEENHLVGIDGPRVELVNWLDAESRLIKCRKVLSIVGFGGLGKTTLANEVYRRVKVHFDCHAFVSVSQKPDFKNIFKDITYNMPTKDGFLKDIDTWNEKKFIEKLRELLVDKRYLVIIDDVWSISAWKAITVAFPDNDCSSTIIVTTRVSDVGWSCCLNGIDRNYQMEPLSEVHSGRLFCKRIFSTNEDGCPDILQEVSTDILKKCGGLPLAIISISGLLANRPVIKEEWEKVKESIGFALDKNQNLEGMKIILSLSFNNLPNYLKTCLLYLSIFPEDCIIERNMVVWRWIAEGFISEDCGQKLEDVAESYFYELINKSLVQPVDIGFDGLEQYLENIDKLFQLEYLSLCCSNISHIPTQIAKLQNLVTLDLRQTCVEEFPTEFCRLIKLQHLLGDRMLKLPDGIGNMRNLQVLSGINISSSSASAVAELGELTSLRDLKISLSDKLSKCKTKEEMLLASLCKLSSYKLQSLHIIDHSTDDFLERWFPIPCFLRLFHMITDYYLLQLPKWVKPYLTKMAYLSINLREIKKEDMETLGDLPALLSLEIWLEPDPKEQLTVQSTGFLFLKEFVLACSDHNGGAYLTFEKGAMPKLEKLEILFHVLMAEPHDFYFGINNLQHLKEVEVFIYRVGAEDSDAEAAVAAIRSEANANPNHPRLAIKEAYVEEISNKECDDNKDAEDQQGGVTVN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF189
8-837 PTHR23155:SF189,OS10G0131000 PROTEIN

SHGALGPLLGKLSTLLADKYACLKGVRREIHSLRSELSNMQAALHKYASLEDPDIQVKAWITELRELAYDIEDCIDKFMHQLGANGEQHRTSNSIEDFFRKSIQRLKTLGPRHNIAGEIEELKARVISVRDQKNSYKLDDIFCSSSSNTNASVDPRLATLFAEENHLVGIDGPRVELVNWLDAESRLIKCRKVLSIVGFGGLGKTTLANEVYRRVKVHFDCHAFVSVSQKPDFKNIFKDITYNMPTKDGFLKDIDTWNEKKFIEKLRELLVDKRYLVIIDDVWSISAWKAITVAFPDNDCSSTIIVTTRVSDVGWSCCLNGIDRNYQMEPLSEVHSGRLFCKRIFSTNEDGCPDILQEVSTDILKKCGGLPLAIISISGLLANRPVIKEEWEKVKESIGFALDKNQNLEGMKIILSLSFNNLPNYLKTCLLYLSIFPEDCIIERNMVVWRWIAEGFISEDCGQKLEDVAESYFYELINKSLVQPVDIGFDGLEQYLENIDKLFQLEYLSLCCSNISHIPTQIAKLQNLVTLDLRQTCVEEFPTEFCRLIKLQHLLGDRMLKLPDGIGNMRNLQVLSGINISSSSASAVAELGELTSLRDLKISLSDKLSKCKTKEEMLLASLCKLSSYKLQSLHIIDHSTDDFLERWFPIPCFLRLFHMITDYYLLQLPKWVKPYLTKMAYLSINLREIKKEDMETLGDLPALLSLEIWLEPDPKEQLTVQSTGFLFLKEFVLACSDHNGGAYLTFEKGAMPKLEKLEILFHVLMAEPHDFYFGINNLQHLKEVEVFIYRVGAEDSDAEAAVAAIRSEANANPNHPRLAIKEAYVEEISN

HMMPanther: PTHR23155
8-837 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SHGALGPLLGKLSTLLADKYACLKGVRREIHSLRSELSNMQAALHKYASLEDPDIQVKAWITELRELAYDIEDCIDKFMHQLGANGEQHRTSNSIEDFFRKSIQRLKTLGPRHNIAGEIEELKARVISVRDQKNSYKLDDIFCSSSSNTNASVDPRLATLFAEENHLVGIDGPRVELVNWLDAESRLIKCRKVLSIVGFGGLGKTTLANEVYRRVKVHFDCHAFVSVSQKPDFKNIFKDITYNMPTKDGFLKDIDTWNEKKFIEKLRELLVDKRYLVIIDDVWSISAWKAITVAFPDNDCSSTIIVTTRVSDVGWSCCLNGIDRNYQMEPLSEVHSGRLFCKRIFSTNEDGCPDILQEVSTDILKKCGGLPLAIISISGLLANRPVIKEEWEKVKESIGFALDKNQNLEGMKIILSLSFNNLPNYLKTCLLYLSIFPEDCIIERNMVVWRWIAEGFISEDCGQKLEDVAESYFYELINKSLVQPVDIGFDGLEQYLENIDKLFQLEYLSLCCSNISHIPTQIAKLQNLVTLDLRQTCVEEFPTEFCRLIKLQHLLGDRMLKLPDGIGNMRNLQVLSGINISSSSASAVAELGELTSLRDLKISLSDKLSKCKTKEEMLLASLCKLSSYKLQSLHIIDHSTDDFLERWFPIPCFLRLFHMITDYYLLQLPKWVKPYLTKMAYLSINLREIKKEDMETLGDLPALLSLEIWLEPDPKEQLTVQSTGFLFLKEFVLACSDHNGGAYLTFEKGAMPKLEKLEILFHVLMAEPHDFYFGINNLQHLKEVEVFIYRVGAEDSDAEAAVAAIRSEANANPNHPRLAIKEAYVEEISN

HMMPanther: PTHR23155:SF189
8-837 PTHR23155:SF189,OS10G0131000 PROTEIN

SHGALGPLLGKLSTLLADKYACLKGVRREIHSLRSELSNMQAALHKYASLEDPDIQVKAWITELRELAYDIEDCIDKFMHQLGANGEQHRTSNSIEDFFRKSIQRLKTLGPRHNIAGEIEELKARVISVRDQKNSYKLDDIFCSSSSNTNASVDPRLATLFAEENHLVGIDGPRVELVNWLDAESRLIKCRKVLSIVGFGGLGKTTLANEVYRRVKVHFDCHAFVSVSQKPDFKNIFKDITYNMPTKDGFLKDIDTWNEKKFIEKLRELLVDKRYLVIIDDVWSISAWKAITVAFPDNDCSSTIIVTTRVSDVGWSCCLNGIDRNYQMEPLSEVHSGRLFCKRIFSTNEDGCPDILQEVSTDILKKCGGLPLAIISISGLLANRPVIKEEWEKVKESIGFALDKNQNLEGMKIILSLSFNNLPNYLKTCLLYLSIFPEDCIIERNMVVWRWIAEGFISEDCGQKLEDVAESYFYELINKSLVQPVDIGFDGLEQYLENIDKLFQLEYLSLCCSNISHIPTQIAKLQNLVTLDLRQTCVEEFPTEFCRLIKLQHLLGDRMLKLPDGIGNMRNLQVLSGINISSSSASAVAELGELTSLRDLKISLSDKLSKCKTKEEMLLASLCKLSSYKLQSLHIIDHSTDDFLERWFPIPCFLRLFHMITDYYLLQLPKWVKPYLTKMAYLSINLREIKKEDMETLGDLPALLSLEIWLEPDPKEQLTVQSTGFLFLKEFVLACSDHNGGAYLTFEKGAMPKLEKLEILFHVLMAEPHDFYFGINNLQHLKEVEVFIYRVGAEDSDAEAAVAAIRSEANANPNHPRLAIKEAYVEEISN

HMMPanther: PTHR23155
8-837 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SHGALGPLLGKLSTLLADKYACLKGVRREIHSLRSELSNMQAALHKYASLEDPDIQVKAWITELRELAYDIEDCIDKFMHQLGANGEQHRTSNSIEDFFRKSIQRLKTLGPRHNIAGEIEELKARVISVRDQKNSYKLDDIFCSSSSNTNASVDPRLATLFAEENHLVGIDGPRVELVNWLDAESRLIKCRKVLSIVGFGGLGKTTLANEVYRRVKVHFDCHAFVSVSQKPDFKNIFKDITYNMPTKDGFLKDIDTWNEKKFIEKLRELLVDKRYLVIIDDVWSISAWKAITVAFPDNDCSSTIIVTTRVSDVGWSCCLNGIDRNYQMEPLSEVHSGRLFCKRIFSTNEDGCPDILQEVSTDILKKCGGLPLAIISISGLLANRPVIKEEWEKVKESIGFALDKNQNLEGMKIILSLSFNNLPNYLKTCLLYLSIFPEDCIIERNMVVWRWIAEGFISEDCGQKLEDVAESYFYELINKSLVQPVDIGFDGLEQYLENIDKLFQLEYLSLCCSNISHIPTQIAKLQNLVTLDLRQTCVEEFPTEFCRLIKLQHLLGDRMLKLPDGIGNMRNLQVLSGINISSSSASAVAELGELTSLRDLKISLSDKLSKCKTKEEMLLASLCKLSSYKLQSLHIIDHSTDDFLERWFPIPCFLRLFHMITDYYLLQLPKWVKPYLTKMAYLSINLREIKKEDMETLGDLPALLSLEIWLEPDPKEQLTVQSTGFLFLKEFVLACSDHNGGAYLTFEKGAMPKLEKLEILFHVLMAEPHDFYFGINNLQHLKEVEVFIYRVGAEDSDAEAAVAAIRSEANANPNHPRLAIKEAYVEEISN

superfamily: SSF52540
157-405 SSF52540

NASVDPRLATLFAEENHLVGIDGPRVELVNWLDAESRLIKCRKVLSIVGFGGLGKTTLANEVYRRVKVHFDCHAFVSVSQKPDFKNIFKDITYNMPTKDGFLKDIDTWNEKKFIEKLRELLVDKRYLVIIDDVWSISAWKAITVAFPDNDCSSTIIVTTRVSDVGWSCCLNGIDRNYQMEPLSEVHSGRLFCKRIFSTNEDGCPDILQEVSTDILKKCGGLPLAIISISGLLANRPVIKEEWEKVKESI

superfamily: SSF52540
157-405 SSF52540

NASVDPRLATLFAEENHLVGIDGPRVELVNWLDAESRLIKCRKVLSIVGFGGLGKTTLANEVYRRVKVHFDCHAFVSVSQKPDFKNIFKDITYNMPTKDGFLKDIDTWNEKKFIEKLRELLVDKRYLVIIDDVWSISAWKAITVAFPDNDCSSTIIVTTRVSDVGWSCCLNGIDRNYQMEPLSEVHSGRLFCKRIFSTNEDGCPDILQEVSTDILKKCGGLPLAIISISGLLANRPVIKEEWEKVKESI

HMMPfam: PF00931
IPR002182
184-467 NB-ARC,NBS
NB-ARC

LVNWLDAESRLIKCRKVLSIVGFGGLGKTTLANEVYRRVKVHFDCHAFVSVSQKPDFKNIFKDITYNMPTKDGFLKDIDTWNEKKFIEKLRELLVDKRYLVIIDDVWSISAWKAITVAFPDNDCSSTIIVTTRVSDVGWSCCLNGIDRNYQMEPLSEVHSGRLFCKRIFSTNEDGCPDILQEVSTDILKKCGGLPLAIISISGLLANRPVIKEEWEKVKESIGFALDKNQNLEGMKIILSLSFNNLPNYLKTCLLYLSIFPEDCIIERNMVVWRWIAEGFISED

HMMPfam: PF00931
IPR002182
184-467 NB-ARC,NBS
NB-ARC

LVNWLDAESRLIKCRKVLSIVGFGGLGKTTLANEVYRRVKVHFDCHAFVSVSQKPDFKNIFKDITYNMPTKDGFLKDIDTWNEKKFIEKLRELLVDKRYLVIIDDVWSISAWKAITVAFPDNDCSSTIIVTTRVSDVGWSCCLNGIDRNYQMEPLSEVHSGRLFCKRIFSTNEDGCPDILQEVSTDILKKCGGLPLAIISISGLLANRPVIKEEWEKVKESIGFALDKNQNLEGMKIILSLSFNNLPNYLKTCLLYLSIFPEDCIIERNMVVWRWIAEGFISED

Gene3D: G3DSA:3.40.50.300
196-292 G3DSA:3.40.50.300

KCRKVLSIVGFGGLGKTTLANEVYRRVKVHFDCHAFVSVSQKPDFKNIFKDITYNMPTKDGFLKDIDTWNEKKFIEKLRELLVDKRYLVIIDDVWSI

Gene3D: G3DSA:3.40.50.300
196-292 G3DSA:3.40.50.300

KCRKVLSIVGFGGLGKTTLANEVYRRVKVHFDCHAFVSVSQKPDFKNIFKDITYNMPTKDGFLKDIDTWNEKKFIEKLRELLVDKRYLVIIDDVWSI

FPrintScan: PR00364
IPR000767
200-215 DISEASERSIST
Disease resistance protein

VLSIVGFGGLGKTTLA

FPrintScan: PR00364
IPR000767
200-215 DISEASERSIST
Disease resistance protein

VLSIVGFGGLGKTTLA

FPrintScan: PR00364
IPR000767
276-290 DISEASERSIST
Disease resistance protein

LLVDKRYLVIIDDVW

FPrintScan: PR00364
IPR000767
276-290 DISEASERSIST
Disease resistance protein

LLVDKRYLVIIDDVW

FPrintScan: PR00364
IPR000767
374-388 DISEASERSIST
Disease resistance protein

CGGLPLAIISISGLL

FPrintScan: PR00364
IPR000767
374-388 DISEASERSIST
Disease resistance protein

CGGLPLAIISISGLL

superfamily: SSF52058
471-844 SSF52058,LRR

KLEDVAESYFYELINKSLVQPVDIGFDGLEQYLENIDKLFQLEYLSLCCSNISHIPTQIAKLQNLVTLDLRQTCVEEFPTEFCRLIKLQHLLGDRMLKLPDGIGNMRNLQVLSGINISSSSASAVAELGELTSLRDLKISLSDKLSKCKTKEEMLLASLCKLSSYKLQSLHIIDHSTDDFLERWFPIPCFLRLFHMITDYYLLQLPKWVKPYLTKMAYLSINLREIKKEDMETLGDLPALLSLEIWLEPDPKEQLTVQSTGFLFLKEFVLACSDHNGGAYLTFEKGAMPKLEKLEILFHVLMAEPHDFYFGINNLQHLKEVEVFIYRVGAEDSDAEAAVAAIRSEANANPNHPRLAIKEAYVEEISNKECDDNK

superfamily: SSF52058
471-844 SSF52058,LRR

KLEDVAESYFYELINKSLVQPVDIGFDGLEQYLENIDKLFQLEYLSLCCSNISHIPTQIAKLQNLVTLDLRQTCVEEFPTEFCRLIKLQHLLGDRMLKLPDGIGNMRNLQVLSGINISSSSASAVAELGELTSLRDLKISLSDKLSKCKTKEEMLLASLCKLSSYKLQSLHIIDHSTDDFLERWFPIPCFLRLFHMITDYYLLQLPKWVKPYLTKMAYLSINLREIKKEDMETLGDLPALLSLEIWLEPDPKEQLTVQSTGFLFLKEFVLACSDHNGGAYLTFEKGAMPKLEKLEILFHVLMAEPHDFYFGINNLQHLKEVEVFIYRVGAEDSDAEAAVAAIRSEANANPNHPRLAIKEAYVEEISNKECDDNK

Gene3D: G3DSA:3.80.10.10
489-643 G3DSA:3.80.10.10

VQPVDIGFDGLEQYLENIDKLFQLEYLSLCCSNISHIPTQIAKLQNLVTLDLRQTCVEEFPTEFCRLIKLQHLLGDRMLKLPDGIGNMRNLQVLSGINISSSSASAVAELGELTSLRDLKISLSDKLSKCKTKEEMLLASLCKLSSYKLQSLHII

Gene3D: G3DSA:3.80.10.10
489-643 G3DSA:3.80.10.10

VQPVDIGFDGLEQYLENIDKLFQLEYLSLCCSNISHIPTQIAKLQNLVTLDLRQTCVEEFPTEFCRLIKLQHLLGDRMLKLPDGIGNMRNLQVLSGINISSSSASAVAELGELTSLRDLKISLSDKLSKCKTKEEMLLASLCKLSSYKLQSLHII

FPrintScan: PR00364
IPR000767
530-546 DISEASERSIST
Disease resistance protein

AKLQNLVTLDLRQTCVE

FPrintScan: PR00364
IPR000767
530-546 DISEASERSIST
Disease resistance protein

AKLQNLVTLDLRQTCVE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox