PRGDB00061799 (Putative disease resistance protein RPR1)

From PRG Wiki
Revision as of 14:32, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Putative disease resistance protein RPR1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 11527448 (AC074283)
Gene Class NL
Domain Type NBS, Ser-Thr Kinase, LRR, GNK2, Others
Gene Species Oryza sativa

Comment?

Oryza sativa chromosome 10 clone OSJNBa0087H07, complete sequence.

DNA Sequence

ATGGCAGAAGCAGTGATACTTTTAGTTGTGAAGAAAATTGGTGCTGCTCTAGGAAATGAAGTAATCAACCAAGCAAGTTCACTGTACAGAAACTTGTTTGCACAGCTTGCAGAACTCCAAGGCAGCATGAGCCGCATATGTCGTGAGCTTAGGTTGATGCATGAATTTCTTTGCAGAATGGACGTACGCAATCGAAATGATCAGGCATATGAAATTTGGGTGGATGAGGTGCGGAAGCTAGCACATGGAATTGAGGACATAGTAGATGAGTATCTACACTTAGTAAGGCAGAGACATGACAAAGGATGGAGCTTTTATCTGAAGAAGGGAATCAATCAACCTGAAGCTTTGCGTTCATTAAACCGGATGGTCTGCCTCATAAAGGAAGCAGAGTCCAGTCTCGTCCACCTATTTCAAGTAAAAGATCGATGGATTCCTAATGCAAGCCCTGGGTATGCCAACAATTCTGGCTATATTGTCGAGAAGTCCCAACATCTAGCAAGTACTTCCCGTTCTATTTGCGAAGATCTCGTGGGAATCGAAGAAAACAGAGATACATTGTTCAATTGGATGAGAGAAGATGGGATGGCATGCTCTACAATAGTTCTTCATGGCATGGGAGGCCTTGGTAAAACAGCTCTAACTGCAAATGTGTACAAGCATGAACAAGAATATTATGACTGTCATGCATGGGTATCTGTTTCACAAACATATTCGCTGATGGAGCTCTTAAAAAAGCTAAGCGTCCAGCTTTTTCATGAGGAAAATATTCAGAGTAATATTGGCAGTATCGACATAATCAATCTTCAGGAGATACTTAGGAGATTCCTTGAAGAGAAGAAATACTTGATAGTGTTGGACGATGTTTGGACACCAGAAGTAATCATCGATATGTCAAGAGCTCTTGCTCAGAATTTTAAGGGAAGTAGATTGCTGATTACTACACGTATTGGTAATGTTGCAGAATTCGCATCGGAAGGACGTGTGCTAACACTAGAGGGTTTGTCAGAAGGAAAGTCTTGGGAACTTTTTTGTAAGAAAGCTTTCCGGAGAGAAGCAAATCACGAATGTCCCACTGAGCTGAAGAATTTGGCGACACAAATGTTGAACAAGTGTAAAGGCTTGCCTCTTGCTATTGTGTCTGTTGGAAGCCTATTGTCCGTGCGTGAGAAGAATCCAACAGAATGGAGACGAATTTATGACCAACTCAGTTGGGAGCTGAATAACAACCCAGGCTTAGACCACGTTAGGAATATTCTGTACTTAAGCTTCATATACCTCCCAACTTATCTGAAGAGTTGTTTCCTGTATTGTACCTTGTTTCCAGAGGACTATATTCTTCATCGGAAGATGCTTTTAAGGTTATGGATTGCAGAGGGGTTCATTGAGGAAAAGGGTGAGAATACATTCGAAGATGTGGCGGAAGGCTATTTAATTGAGCTGGTTCACAGAAATATGCTGCAGCTTATGGAATGCAACTCATTTGGCAGAATAAAATCCTGTAAGATGCATGACATTGTTCGTGAGTTGGCGATTGACCTGTCTCAGAAACAAAGTTTTGGTCTTGCATACTACGAGTATGGAAATCGTTGTAGTACCATGGACACAAGCATACGCCGTCTCGCGGTAGCTAAATGCAGCAATAATATTTTATCAAGTATATGCTTACCTCGTCTTCGATCTTGCATTGTATTTGATAAGGCCATGCCATCCTTGAGAATAATTAAGTCAATATCAGACAAGTCAAAGTACATTGTTGTACTAGAACTACGTGGGCTGGCGATTGAAAAAGTGCCAGATGCTGTTGGATGCCTTTTCAACCTACGCTATTTGGGTTTGCGCCATTCGAAGGTGAAGTTTCTCCCCAAGTCCGTGGAGAGGCTCTCCAACTTATTGACGTTGGATATTTTCAACTCCTACATACAAGAACTGCCTCAAGGAATAGTCAAGCTGAAGAGTCTGAGGCACTTACTTGTTGAGAGAATCAATGATCCGTCATGGAGGGATTTTAGAAGTCGCCACGGTGTTTGCATCCCAAAGGGTCTTTCGAATTTCACAAATCTGCAGACATTACATGCAATTGAAGCACAGGACCGGACTGTTAAAGACTTGGGGGAGTTGACACAGCTAAAAAGCTTAAGGGTGTGGAATGTGAAGGAAATCCACTGTGAACGCCTCTGCGTGTCTATACTTAAGATGAGATTTTTGTACCACATTCATATAGCTGCATGTGACGAGAGTGAGGTTCAACTGAATAAGCTAGATCCCCCACCGCTAAGCCTTCAGAAACTCTGTTTGAGAGGGAGATTGGCAGAGGGGACACTTGAGTCTCCTCTTTTCCAAACTGGTGGACAGAAATTGCGTGGACTTTTTCTTGTTTGGTCTCAGTTGAAACAAGATCCCCTCCCGCCTATCTCTCGATTATGTAATCTGACACAGCTGAATCTTACAAGAGCATATGTTGGGGAACTGTTAATATTCAGGAGCGGTTGGTTTCCCAGTTTGAAGTTTCTGTTACTGCGGGACTTGCCTAATCTACATCGGTTAGAGATTGAGGAAGGTGCCGGGATAGGTATTCGTGTTTTGCAGCTTAGACACCTTGACAAGCTGATGGATATTCCACCTGGCATCGAGTTTCTTCCATCCCTCCAACGTCTATGCTTTGTCCATATCAGTGAAGATTTCCTTGCATTGCTAAATCGGTGTTCTAGGCTCAAGCACATTCAGTGGTGGTATTCAACGCATGATCAGCCTCTGACGAAGAAATGTACGTCGCTCAACTAG


Protein sequences

Name Description Sequence
Putative receptor-like protein kinase 4 Putative receptor-like protein kinase 4 [Oryza sativa].

MVGVLLLLSIMPLAAGELLAQLCGNGGNYTANGTYQSNLARLAAALPSNASSSPDHFATATAGQAPDAAYALALCRGDVANATACGDCVAASFQDARRTCPSDKSATIYYDDCLLRFAGDDFLAAPNITENATLFQAWNQQNITGDAAVAAANVRELLTVTARTAAAAARRFATGFMDGSSESKQTLYSLAQCTPDLAAGDCLACLQRLIAMVNSTTSVRLGGRVLLLRCNLRFEAFVFYAGEPTRRVSPPGSTPAPDSIAPTKNRKKSKSWVIAAIAAPVAAVVLCLIVCYYCRWSRRFRKDRVRLREKRSRRFRGDELICEMEGEISEFSVFEFREVIKATDNFSEENKLGEGGFGPVYKGLFSEGLEIAVKRLASHSGQGFLEFKNEVQLIAKLQHRNLVRLLGCCSQGEEKILVYEYLPNKSLDFYIFDERKKDLLDWNKRLVIIEGIAQGLLYLHKHSRLRVIHRDLKPSNILLDSEMNPKISDFGLAKIFGSNSNEGTTRRVVGTYGYMAPEYSSEGLFSPKSDVFSFGVIILEIISGKRNASLDQCEDFINLLGYAWKLWSEERWLELLDASLVTNWQSSCMLRCINIALLCVQENAVDRPTMSNVVAMLSSESMVLDEPKHPAYFHINENIL

Putative disease resistance protein RPR1 Putative disease resistance protein RPR1 [Oryza sativa].

MAEAVILLVVKKIGAALGNEVINQASSLYRNLFAQLAELQGSMSRICRELRLMHEFLCRMDVRNRNDQAYEIWVDEVRKLAHGIEDIVDEYLHLVRQRHDKGWSFYLKKGINQPEALRSLNRMVCLIKEAESSLVHLFQVKDRWIPNASPGYANNSGYIVEKSQHLASTSRSICEDLVGIEENRDTLFNWMREDGMACSTIVLHGMGGLGKTALTANVYKHEQEYYDCHAWVSVSQTYSLMELLKKLSVQLFHEENIQSNIGSIDIINLQEILRRFLEEKKYLIVLDDVWTPEVIIDMSRALAQNFKGSRLLITTRIGNVAEFASEGRVLTLEGLSEGKSWELFCKKAFRREANHECPTELKNLATQMLNKCKGLPLAIVSVGSLLSVREKNPTEWRRIYDQLSWELNNNPGLDHVRNILYLSFIYLPTYLKSCFLYCTLFPEDYILHRKMLLRLWIAEGFIEEKGENTFEDVAEGYLIELVHRNMLQLMECNSFGRIKSCKMHDIVRELAIDLSQKQSFGLAYYEYGNRCSTMDTSIRRLAVAKCSNNILSSICLPRLRSCIVFDKAMPSLRIIKSISDKSKYIVVLELRGLAIEKVPDAVGCLFNLRYLGLRHSKVKFLPKSVERLSNLLTLDIFNSYIQELPQGIVKLKSLRHLLVERINDPSWRDFRSRHGVCIPKGLSNFTNLQTLHAIEAQDRTVKDLGELTQLKSLRVWNVKEIHCERLCVSILKMRFLYHIHIAACDESEVQLNKLDPPPLSLQKLCLRGRLAEGTLESPLFQTGGQKLRGLFLVWSQLKQDPLPPISRLCNLTQLNLTRAYVGELLIFRSGWFPSLKFLLLRDLPNLHRLEIEEGAGIGIRVLQLRHLDKLMDIPPGIEFLPSLQRLCFVHISEDFLALLNRCSRLKHIQWWYSTHDQPLTKKCTSLN

Putative receptor-like protein kinase 4 Putative receptor-like protein kinase 4 [Oryza sativa].

MVGVLLLLSIMPLAAGELLAQLCGNGGNYTANGTYQSNLARLAAALPSNASSSPDHFATATAGQAPDAAYALALCRGDVANATACGDCVAASFQDARRTCPSDKSATIYYDDCLLRFAGDDFLAAPNITENATLFQAWNQQNITGDAAVAAANVRELLTVTARTAAAAARRFATGFMDGSSESKQTLYSLAQCTPDLAAGDCLACLQRLIAMVNSTTSVRLGGRVLLLRCNLRFEAFVFYAGEPTRRVSPPGSTPAPDSIAPTKNRKKSKSWVIAAIAAPVAAVVLCLIVCYYCRWSRRFRKDRVRLREKRSRRFRGDELICEMEGEISEFSVFEFREVIKATDNFSEENKLGEGGFGPVYKGLFSEGLEIAVKRLASHSGQGFLEFKNEVQLIAKLQHRNLVRLLGCCSQGEEKILVYEYLPNKSLDFYIFDERKKDLLDWNKRLVIIEGIAQGLLYLHKHSRLRVIHRDLKPSNILLDSEMNPKISDFGLAKIFGSNSNEGTTRRVVGTYGYMAPEYSSEGLFSPKSDVFSFGVIILEIISGKRNASLDQCEDFINLLGYAWKLWSEERWLELLDASLVTNWQSSCMLRCINIALLCVQENAVDRPTMSNVVAMLSSESMVLDEPKHPAYFHINENIL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF207
11-886 OS11G0560000 PROTEIN,OS11G0560000 PROTEIN

KKIGAALGNEVINQASSLYRNLFAQLAELQGSMSRICRELRLMHEFLCRMDVRNRNDQAYEIWVDEVRKLAHGIEDIVDEYLHLVRQRHDKGWSFYLKKGINQPEALRSLNRMVCLIKEAESSLVHLFQVKDRWIPNASPGYANNSGYIVEKSQHLASTSRSICEDLVGIEENRDTLFNWMREDGMACSTIVLHGMGGLGKTALTANVYKHEQEYYDCHAWVSVSQTYSLMELLKKLSVQLFHEENIQSNIGSIDIINLQEILRRFLEEKKYLIVLDDVWTPEVIIDMSRALAQNFKGSRLLITTRIGNVAEFASEGRVLTLEGLSEGKSWELFCKKAFRREANHECPTELKNLATQMLNKCKGLPLAIVSVGSLLSVREKNPTEWRRIYDQLSWELNNNPGLDHVRNILYLSFIYLPTYLKSCFLYCTLFPEDYILHRKMLLRLWIAEGFIEEKGENTFEDVAEGYLIELVHRNMLQLMECNSFGRIKSCKMHDIVRELAIDLSQKQSFGLAYYEYGNRCSTMDTSIRRLAVAKCSNNILSSICLPRLRSCIVFDKAMPSLRIIKSISDKSKYIVVLELRGLAIEKVPDAVGCLFNLRYLGLRHSKVKFLPKSVERLSNLLTLDIFNSYIQELPQGIVKLKSLRHLLVERINDPSWRDFRSRHGVCIPKGLSNFTNLQTLHAIEAQDRTVKDLGELTQLKSLRVWNVKEIHCERLCVSILKMRFLYHIHIAACDESEVQLNKLDPPPLSLQKLCLRGRLAEGTLESPLFQTGGQKLRGLFLVWSQLKQDPLPPISRLCNLTQLNLTRAYVGELLIFRSGWFPSLKFLLLRDLPNLHRLEIEEGAGIGIRVLQLRHLDKLMDIPPGIEFLPSLQRL

HMMPanther: PTHR23155
11-886 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KKIGAALGNEVINQASSLYRNLFAQLAELQGSMSRICRELRLMHEFLCRMDVRNRNDQAYEIWVDEVRKLAHGIEDIVDEYLHLVRQRHDKGWSFYLKKGINQPEALRSLNRMVCLIKEAESSLVHLFQVKDRWIPNASPGYANNSGYIVEKSQHLASTSRSICEDLVGIEENRDTLFNWMREDGMACSTIVLHGMGGLGKTALTANVYKHEQEYYDCHAWVSVSQTYSLMELLKKLSVQLFHEENIQSNIGSIDIINLQEILRRFLEEKKYLIVLDDVWTPEVIIDMSRALAQNFKGSRLLITTRIGNVAEFASEGRVLTLEGLSEGKSWELFCKKAFRREANHECPTELKNLATQMLNKCKGLPLAIVSVGSLLSVREKNPTEWRRIYDQLSWELNNNPGLDHVRNILYLSFIYLPTYLKSCFLYCTLFPEDYILHRKMLLRLWIAEGFIEEKGENTFEDVAEGYLIELVHRNMLQLMECNSFGRIKSCKMHDIVRELAIDLSQKQSFGLAYYEYGNRCSTMDTSIRRLAVAKCSNNILSSICLPRLRSCIVFDKAMPSLRIIKSISDKSKYIVVLELRGLAIEKVPDAVGCLFNLRYLGLRHSKVKFLPKSVERLSNLLTLDIFNSYIQELPQGIVKLKSLRHLLVERINDPSWRDFRSRHGVCIPKGLSNFTNLQTLHAIEAQDRTVKDLGELTQLKSLRVWNVKEIHCERLCVSILKMRFLYHIHIAACDESEVQLNKLDPPPLSLQKLCLRGRLAEGTLESPLFQTGGQKLRGLFLVWSQLKQDPLPPISRLCNLTQLNLTRAYVGELLIFRSGWFPSLKFLLLRDLPNLHRLEIEEGAGIGIRVLQLRHLDKLMDIPPGIEFLPSLQRL

ProfileScan: PS51473
IPR002902
17-122 GNK2,Gnk2-homologous domain profile.
Gnk2-homologous domain

ELLAQLCGNGGNYTANGTYQSNLARLAAALPSNASSSPDHFATATAGQAPDAAYALALCRGDVANATACGDCVAASFQDARRTCPSDKSATIYYDDCLLRFAGDDF

ProfileScan: PS51473
IPR002902
17-122 GNK2,Gnk2-homologous domain profile.
Gnk2-homologous domain

ELLAQLCGNGGNYTANGTYQSNLARLAAALPSNASSSPDHFATATAGQAPDAAYALALCRGDVANATACGDCVAASFQDARRTCPSDKSATIYYDDCLLRFAGDDF

HMMPfam: PF01657
IPR002902
21-120 Stress-antifung
Gnk2-homologous domain

QLCGNGGNYTANGTYQSNLARLAAALPSNASSSPDHFATATAGQAPDAAYALALCRGDVANATACGDCVAASFQDARRTCPSDKSATIYYDDCLLRFAGD

HMMPfam: PF01657
IPR002902
21-120 Stress-antifung
Gnk2-homologous domain

QLCGNGGNYTANGTYQSNLARLAAALPSNASSSPDHFATATAGQAPDAAYALALCRGDVANATACGDCVAASFQDARRTCPSDKSATIYYDDCLLRFAGD

Seg: seg
24-35 seg

GNGGNYTANGTY

Seg: seg
24-35 seg

GNGGNYTANGTY

Seg: seg
37-54 seg

SNLARLAAALPSNASSSP

Seg: seg
37-54 seg

SNLARLAAALPSNASSSP

Seg: seg
58-71 seg

ATATAGQAPDAAYA

Seg: seg
58-71 seg

ATATAGQAPDAAYA

HMMPanther: PTHR24420:SF430
93-637 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

FQDARRTCPSDKSATIYYDDCLLRFAGDDFLAAPNITENATLFQAWNQQNITGDAAVAAANVRELLTVTARTAAAAARRFATGFMDGSSESKQTLYSLAQCTPDLAAGDCLACLQRLIAMVNSTTSVRLGGRVLLLRCNLRFEAFVFYAGEPTRRVSPPGSTPAPDSIAPTKNRKKSKSWVIAAIAAPVAAVVLCLIVCYYCRWSRRFRKDRVRLREKRSRRFRGDELICEMEGEISEFSVFEFREVIKATDNFSEENKLGEGGFGPVYKGLFSEGLEIAVKRLASHSGQGFLEFKNEVQLIAKLQHRNLVRLLGCCSQGEEKILVYEYLPNKSLDFYIFDERKKDLLDWNKRLVIIEGIAQGLLYLHKHSRLRVIHRDLKPSNILLDSEMNPKISDFGLAKIFGSNSNEGTTRRVVGTYGYMAPEYSSEGLFSPKSDVFSFGVIILEIISGKRNASLDQCEDFINLLGYAWKLWSEERWLELLDASLVTNWQSSCMLRCINIALLCVQENAVDRPTMSNVVAMLSSESMVLDEPKHPAYFHINE

HMMPanther: PTHR24420
93-637 FAMILY NOT NAMED,FAMILY NOT NAMED

FQDARRTCPSDKSATIYYDDCLLRFAGDDFLAAPNITENATLFQAWNQQNITGDAAVAAANVRELLTVTARTAAAAARRFATGFMDGSSESKQTLYSLAQCTPDLAAGDCLACLQRLIAMVNSTTSVRLGGRVLLLRCNLRFEAFVFYAGEPTRRVSPPGSTPAPDSIAPTKNRKKSKSWVIAAIAAPVAAVVLCLIVCYYCRWSRRFRKDRVRLREKRSRRFRGDELICEMEGEISEFSVFEFREVIKATDNFSEENKLGEGGFGPVYKGLFSEGLEIAVKRLASHSGQGFLEFKNEVQLIAKLQHRNLVRLLGCCSQGEEKILVYEYLPNKSLDFYIFDERKKDLLDWNKRLVIIEGIAQGLLYLHKHSRLRVIHRDLKPSNILLDSEMNPKISDFGLAKIFGSNSNEGTTRRVVGTYGYMAPEYSSEGLFSPKSDVFSFGVIILEIISGKRNASLDQCEDFINLLGYAWKLWSEERWLELLDASLVTNWQSSCMLRCINIALLCVQENAVDRPTMSNVVAMLSSESMVLDEPKHPAYFHINE

HMMPanther: PTHR24420:SF430
93-637 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

FQDARRTCPSDKSATIYYDDCLLRFAGDDFLAAPNITENATLFQAWNQQNITGDAAVAAANVRELLTVTARTAAAAARRFATGFMDGSSESKQTLYSLAQCTPDLAAGDCLACLQRLIAMVNSTTSVRLGGRVLLLRCNLRFEAFVFYAGEPTRRVSPPGSTPAPDSIAPTKNRKKSKSWVIAAIAAPVAAVVLCLIVCYYCRWSRRFRKDRVRLREKRSRRFRGDELICEMEGEISEFSVFEFREVIKATDNFSEENKLGEGGFGPVYKGLFSEGLEIAVKRLASHSGQGFLEFKNEVQLIAKLQHRNLVRLLGCCSQGEEKILVYEYLPNKSLDFYIFDERKKDLLDWNKRLVIIEGIAQGLLYLHKHSRLRVIHRDLKPSNILLDSEMNPKISDFGLAKIFGSNSNEGTTRRVVGTYGYMAPEYSSEGLFSPKSDVFSFGVIILEIISGKRNASLDQCEDFINLLGYAWKLWSEERWLELLDASLVTNWQSSCMLRCINIALLCVQENAVDRPTMSNVVAMLSSESMVLDEPKHPAYFHINE

HMMPanther: PTHR24420
93-637 FAMILY NOT NAMED,FAMILY NOT NAMED

FQDARRTCPSDKSATIYYDDCLLRFAGDDFLAAPNITENATLFQAWNQQNITGDAAVAAANVRELLTVTARTAAAAARRFATGFMDGSSESKQTLYSLAQCTPDLAAGDCLACLQRLIAMVNSTTSVRLGGRVLLLRCNLRFEAFVFYAGEPTRRVSPPGSTPAPDSIAPTKNRKKSKSWVIAAIAAPVAAVVLCLIVCYYCRWSRRFRKDRVRLREKRSRRFRGDELICEMEGEISEFSVFEFREVIKATDNFSEENKLGEGGFGPVYKGLFSEGLEIAVKRLASHSGQGFLEFKNEVQLIAKLQHRNLVRLLGCCSQGEEKILVYEYLPNKSLDFYIFDERKKDLLDWNKRLVIIEGIAQGLLYLHKHSRLRVIHRDLKPSNILLDSEMNPKISDFGLAKIFGSNSNEGTTRRVVGTYGYMAPEYSSEGLFSPKSDVFSFGVIILEIISGKRNASLDQCEDFINLLGYAWKLWSEERWLELLDASLVTNWQSSCMLRCINIALLCVQENAVDRPTMSNVVAMLSSESMVLDEPKHPAYFHINE

ProfileScan: PS51473
IPR002902
131-239 GNK2,Gnk2-homologous domain profile.
Gnk2-homologous domain

NATLFQAWNQQNITGDAAVAAANVRELLTVTARTAAAAARRFATGFMDGSSESKQTLYSLAQCTPDLAAGDCLACLQRLIAMVNSTTSVRLGGRVLLLRCNLRFEAFVF

ProfileScan: PS51473
IPR002902
131-239 GNK2,Gnk2-homologous domain profile.
Gnk2-homologous domain

NATLFQAWNQQNITGDAAVAAANVRELLTVTARTAAAAARRFATGFMDGSSESKQTLYSLAQCTPDLAAGDCLACLQRLIAMVNSTTSVRLGGRVLLLRCNLRFEAFVF

HMMPfam: PF01657
IPR002902
141-235 Stress-antifung
Gnk2-homologous domain

QNITGDAAVAAANVRELLTVTARTAAAAARRFATGFMDGSSESKQTLYSLAQCTPDLAAGDCLACLQRLIAMVNSTTSVRLGGRVLLLRCNLRFE

HMMPfam: PF01657
IPR002902
141-235 Stress-antifung
Gnk2-homologous domain

QNITGDAAVAAANVRELLTVTARTAAAAARRFATGFMDGSSESKQTLYSLAQCTPDLAAGDCLACLQRLIAMVNSTTSVRLGGRVLLLRCNLRFE

superfamily: SSF52540
158-410 P-loop containing nucleoside triphosphate hydrolases

YIVEKSQHLASTSRSICEDLVGIEENRDTLFNWMREDGMACSTIVLHGMGGLGKTALTANVYKHEQEYYDCHAWVSVSQTYSLMELLKKLSVQLFHEENIQSNIGSIDIINLQEILRRFLEEKKYLIVLDDVWTPEVIIDMSRALAQNFKGSRLLITTRIGNVAEFASEGRVLTLEGLSEGKSWELFCKKAFRREANHECPTELKNLATQMLNKCKGLPLAIVSVGSLLSVREKNPTEWRRIYDQLSWELNNN

Seg: seg
161-174 seg

TARTAAAAARRFAT

Seg: seg
161-174 seg

TARTAAAAARRFAT

HMMPfam: PF00931
IPR002182
184-464 NB-ARC,NBS
NB-ARC

RDTLFNWMREDGMACSTIVLHGMGGLGKTALTANVYKHEQEYYDCHAWVSVSQTYSLMELLKKLSVQLFHEENIQSNIGSIDIINLQEILRRFLEEKKYLIVLDDVWTPEVIIDMSRALAQNFKGSRLLITTRIGNVAEFASEGRVLTLEGLSEGKSWELFCKKAFRREANHECPTELKNLATQMLNKCKGLPLAIVSVGSLLSVREKNPTEWRRIYDQLSWELNNNPGLDHVRNILYLSFIYLPTYLKSCFLYCTLFPEDYILHRKMLLRLWIAEGFIEE

FPrintScan: PR00364
IPR000767
200-215 DISEASERSIST
Disease resistance protein

TIVLHGMGGLGKTALT

Seg: seg
219-229 seg

VRLGGRVLLLR

Seg: seg
219-229 seg

VRLGGRVLLLR

Seg: seg
273-291 seg

VIAAIAAPVAAVVLCLIVC

Seg: seg
273-291 seg

VIAAIAAPVAAVVLCLIVC

FPrintScan: PR00364
IPR000767
276-290 DISEASERSIST
Disease resistance protein

FLEEKKYLIVLDDVW

superfamily: SSF56112
IPR011009
318-640 Protein kinase-like (PK-like)
Protein kinase-like domain

DELICEMEGEISEFSVFEFREVIKATDNFSEENKLGEGGFGPVYKGLFSEGLEIAVKRLASHSGQGFLEFKNEVQLIAKLQHRNLVRLLGCCSQGEEKILVYEYLPNKSLDFYIFDERKKDLLDWNKRLVIIEGIAQGLLYLHKHSRLRVIHRDLKPSNILLDSEMNPKISDFGLAKIFGSNSNEGTTRRVVGTYGYMAPEYSSEGLFSPKSDVFSFGVIILEIISGKRNASLDQCEDFINLLGYAWKLWSEERWLELLDASLVTNWQSSCMLRCINIALLCVQENAVDRPTMSNVVAMLSSESMVLDEPKHPAYFHINENIL

superfamily: SSF56112
IPR011009
318-640 Protein kinase-like (PK-like)
Protein kinase-like domain

DELICEMEGEISEFSVFEFREVIKATDNFSEENKLGEGGFGPVYKGLFSEGLEIAVKRLASHSGQGFLEFKNEVQLIAKLQHRNLVRLLGCCSQGEEKILVYEYLPNKSLDFYIFDERKKDLLDWNKRLVIIEGIAQGLLYLHKHSRLRVIHRDLKPSNILLDSEMNPKISDFGLAKIFGSNSNEGTTRRVVGTYGYMAPEYSSEGLFSPKSDVFSFGVIILEIISGKRNASLDQCEDFINLLGYAWKLWSEERWLELLDASLVTNWQSSCMLRCINIALLCVQENAVDRPTMSNVVAMLSSESMVLDEPKHPAYFHINENIL

Gene3D: G3DSA:3.30.200.20
329-407 no description

SEFSVFEFREVIKATDNFSEENKLGEGGFGPVYKGLFSEGLEIAVKRLASHSGQGFLEFKNEVQLIAKLQHRNLVRLLG

Gene3D: G3DSA:3.30.200.20
329-407 no description

SEFSVFEFREVIKATDNFSEENKLGEGGFGPVYKGLFSEGLEIAVKRLASHSGQGFLEFKNEVQLIAKLQHRNLVRLLG

ProfileScan: PS50011
IPR000719
346-632 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEENKLGEGGFGPVYKGLFSEGLEIAVKRLASHSGQGFLEFKNEVQLIAKLQHRNLVRLLGCCSQGEEKILVYEYLPNKSLDFYIFDERKKDLLDWNKRLVIIEGIAQGLLYLHKHSRLRVIHRDLKPSNILLDSEMNPKISDFGLAKIFGSNSNEGTTRRVVGTYGYMAPEYSSEGLFSPKSDVFSFGVIILEIISGKRNASLDQCEDFINLLGYAWKLWSEERWLELLDASLVTNWQSSCMLRCINIALLCVQENAVDRPTMSNVVAMLSSESMVLDEPKHPAY

ProfileScan: PS50011
IPR000719
346-632 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEENKLGEGGFGPVYKGLFSEGLEIAVKRLASHSGQGFLEFKNEVQLIAKLQHRNLVRLLGCCSQGEEKILVYEYLPNKSLDFYIFDERKKDLLDWNKRLVIIEGIAQGLLYLHKHSRLRVIHRDLKPSNILLDSEMNPKISDFGLAKIFGSNSNEGTTRRVVGTYGYMAPEYSSEGLFSPKSDVFSFGVIILEIISGKRNASLDQCEDFINLLGYAWKLWSEERWLELLDASLVTNWQSSCMLRCINIALLCVQENAVDRPTMSNVVAMLSSESMVLDEPKHPAY

HMMSmart: SM00220
IPR002290
346-622 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSEENKLGEGGFGPVYKGLFSEGLEIAVKRLASHSGQGFLEFKNEVQLIAKLQHRNLVRLLGCCSQGEEKILVYEYLPNKSLDFYIFDERKKDLLDWNKRLVIIEGIAQGLLYLHKHSRLRVIHRDLKPSNILLDSEMNPKISDFGLAKIFGSNSNEGTTRRVVGTYGYMAPEYSSEGLFSPKSDVFSFGVIILEIISGKRNASLDQCEDFINLLGYAWKLWSEERWLELLDASLVTNWQSSCMLRCINIALLCVQENAVDRPTMSNVVAMLSSESM

HMMSmart: SM00219
IPR020635
346-617 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSEENKLGEGGFGPVYKGLFSEGLEIAVKRLASHSGQGFLEFKNEVQLIAKLQHRNLVRLLGCCSQGEEKILVYEYLPNKSLDFYIFDERKKDLLDWNKRLVIIEGIAQGLLYLHKHSRLRVIHRDLKPSNILLDSEMNPKISDFGLAKIFGSNSNEGTTRRVVGTYGYMAPEYSSEGLFSPKSDVFSFGVIILEIISGKRNASLDQCEDFINLLGYAWKLWSEERWLELLDASLVTNWQSSCMLRCINIALLCVQENAVDRPTMSNVVAML

HMMSmart: SM00219
IPR020635
346-617 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSEENKLGEGGFGPVYKGLFSEGLEIAVKRLASHSGQGFLEFKNEVQLIAKLQHRNLVRLLGCCSQGEEKILVYEYLPNKSLDFYIFDERKKDLLDWNKRLVIIEGIAQGLLYLHKHSRLRVIHRDLKPSNILLDSEMNPKISDFGLAKIFGSNSNEGTTRRVVGTYGYMAPEYSSEGLFSPKSDVFSFGVIILEIISGKRNASLDQCEDFINLLGYAWKLWSEERWLELLDASLVTNWQSSCMLRCINIALLCVQENAVDRPTMSNVVAML

HMMSmart: SM00220
IPR002290
346-622 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSEENKLGEGGFGPVYKGLFSEGLEIAVKRLASHSGQGFLEFKNEVQLIAKLQHRNLVRLLGCCSQGEEKILVYEYLPNKSLDFYIFDERKKDLLDWNKRLVIIEGIAQGLLYLHKHSRLRVIHRDLKPSNILLDSEMNPKISDFGLAKIFGSNSNEGTTRRVVGTYGYMAPEYSSEGLFSPKSDVFSFGVIILEIISGKRNASLDQCEDFINLLGYAWKLWSEERWLELLDASLVTNWQSSCMLRCINIALLCVQENAVDRPTMSNVVAMLSSESM

HMMPfam: PF07714
IPR001245
349-617 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

ENKLGEGGFGPVYKGLFSEGLEIAVKRLASHSGQGFLEFKNEVQLIAKLQHRNLVRLLGCCSQGEEKILVYEYLPNKSLDFYIFDERKKDLLDWNKRLVIIEGIAQGLLYLHKHSRLRVIHRDLKPSNILLDSEMNPKISDFGLAKIFGSNSNEGTTRRVVGTYGYMAPEYSSEGLFSPKSDVFSFGVIILEIISGKRNASLDQCEDFINLLGYAWKLWSEERWLELLDASLVTNWQSSCMLRCINIALLCVQENAVDRPTMSNVVAML

HMMPfam: PF07714
IPR001245
349-617 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

ENKLGEGGFGPVYKGLFSEGLEIAVKRLASHSGQGFLEFKNEVQLIAKLQHRNLVRLLGCCSQGEEKILVYEYLPNKSLDFYIFDERKKDLLDWNKRLVIIEGIAQGLLYLHKHSRLRVIHRDLKPSNILLDSEMNPKISDFGLAKIFGSNSNEGTTRRVVGTYGYMAPEYSSEGLFSPKSDVFSFGVIILEIISGKRNASLDQCEDFINLLGYAWKLWSEERWLELLDASLVTNWQSSCMLRCINIALLCVQENAVDRPTMSNVVAML

FPrintScan: PR00364
IPR000767
372-386 DISEASERSIST
Disease resistance protein

CKGLPLAIVSVGSLL

Gene3D: G3DSA:1.10.510.10
408-617 no description

CCSQGEEKILVYEYLPNKSLDFYIFDERKKDLLDWNKRLVIIEGIAQGLLYLHKHSRLRVIHRDLKPSNILLDSEMNPKISDFGLAKIFGSNSNEGTTRRVVGTYGYMAPEYSSEGLFSPKSDVFSFGVIILEIISGKRNASLDQCEDFINLLGYAWKLWSEERWLELLDASLVTNWQSSCMLRCINIALLCVQENAVDRPTMSNVVAML

Gene3D: G3DSA:1.10.510.10
408-617 no description

CCSQGEEKILVYEYLPNKSLDFYIFDERKKDLLDWNKRLVIIEGIAQGLLYLHKHSRLRVIHRDLKPSNILLDSEMNPKISDFGLAKIFGSNSNEGTTRRVVGTYGYMAPEYSSEGLFSPKSDVFSFGVIILEIISGKRNASLDQCEDFINLLGYAWKLWSEERWLELLDASLVTNWQSSCMLRCINIALLCVQENAVDRPTMSNVVAML

PatternScan: PS00108
IPR008271
467-479 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDLKPSNILL

PatternScan: PS00108
IPR008271
467-479 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDLKPSNILL

superfamily: SSF52058
486-915 L domain-like,LRR

MLQLMECNSFGRIKSCKMHDIVRELAIDLSQKQSFGLAYYEYGNRCSTMDTSIRRLAVAKCSNNILSSICLPRLRSCIVFDKAMPSLRIIKSISDKSKYIVVLELRGLAIEKVPDAVGCLFNLRYLGLRHSKVKFLPKSVERLSNLLTLDIFNSYIQELPQGIVKLKSLRHLLVERINDPSWRDFRSRHGVCIPKGLSNFTNLQTLHAIEAQDRTVKDLGELTQLKSLRVWNVKEIHCERLCVSILKMRFLYHIHIAACDESEVQLNKLDPPPLSLQKLCLRGRLAEGTLESPLFQTGGQKLRGLFLVWSQLKQDPLPPISRLCNLTQLNLTRAYVGELLIFRSGWFPSLKFLLLRDLPNLHRLEIEEGAGIGIRVLQLRHLDKLMDIPPGIEFLPSLQRLCFVHISEDFLALLNRCSRLKHIQWWYSTH

Gene3D: G3DSA:3.80.10.10
513-756 no description

DLSQKQSFGLAYYEYGNRCSTMDTSIRRLAVAKCSNNILSSICLPRLRSCIVFDKAMPSLRIIKSISDKSKYIVVLELRGLAIEKVPDAVGCLFNLRYLGLRHSKVKFLPKSVERLSNLLTLDIFNSYIQELPQGIVKLKSLRHLLVERINDPSWRDFRSRHGVCIPKGLSNFTNLQTLHAIEAQDRTVKDLGELTQLKSLRVWNVKEIHCERLCVSILKMRFLYHIHIAACDESEVQLNKLDP

Seg: seg
574-583 seg

IIKSISDKSK

FPrintScan: PR00364
IPR000767
626-642 DISEASERSIST
Disease resistance protein

ERLSNLLTLDIFNSYIQ

Gene3D: G3DSA:3.80.10.10
757-889 no description

PPLSLQKLCLRGRLAEGTLESPLFQTGGQKLRGLFLVWSQLKQDPLPPISRLCNLTQLNLTRAYVGELLIFRSGWFPSLKFLLLRDLPNLHRLEIEEGAGIGIRVLQLRHLDKLMDIPPGIEFLPSLQRLCFV

Seg: seg
838-849 seg

LLLRDLPNLHRL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox