PRGDB00061813 (NBS-LRR disease resistance protein)

From PRG Wiki
Revision as of 14:33, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
NBS-LRR disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 320154501 (GU258504)
Gene Class Unknown
Domain Type LRR
Gene Species Oryza rufipogon

Comment?

Oryza rufipogon seed accession number 81978 NBS-LRR disease resistance protein (Pikh) gene, complete cds.

DNA Sequence

ATGCCTCATGCAATGGGCCAACTTATAAATCTTCACACATTGCTTGGTTACTTTGTCCCCAACAATGGAAGTAGTGCGATGTCAGAGCTTCAATCACTGCCAGACCTCAATAGACTATCACTAGTGAACCTTGAAAAGGTTTCAGACACTGAAGATGCAAGAATGGCAAAACTTCAAGAGAAAGAAAAGCTCGAGACATTGATGTTGAGGTGGAATATGGATGCTGGAAATGCCAGTAGAATAGATTATGAAGTACTTGAAACCCTCCAACCTAGCCAGTGCCTGAAAACTTTGGAGATTGTTGCGTATGAAGGACATGTATTTCCATCTTGGATAACAAGCACTGAGCCATATCTCACATCTCTGGTTGAGATAAGGCTGGTTAATCTGAGATCATGTGAAAATGCTTTACCTCCACTTGGGCTACTGCCATGTCTGAAGATTGTGGAGATAAGCCGAGTTGATAATATCAGTTGTATTGACGATAATTTCTATGGTCACAACGGTACATTTCCTTCACTGGAGAAGCTGATTCTCTCATTCATGACTAGCCTTGAAGTCTGGGAACAGTCATCTAGGATGAATCTGTTTCCTCGTCTTGCAGAACTTGTCATCATTCAGTGCCCAAAATTGAGAGCACTGCATATGGAGTTTCCATCGATTGAAAAATTGATTTTGTGGATGAATAACAAGATGTTGTACAGCTCAAAGGAAGGTCTGAGAGGTGTAGAGAAGAGCCTCGAAAATCTTTCAATTTCTTTCTGTGAAGAGTTGCATGCTTCTTCAGGCTGTGAGGGTCTACAGGCTCTTGATCGCCTCAAGAAGTTGGAGATATGTGGTTGTCATGAATTGTCATGCCTCCCACAGGGTTTGCAGCATCTTTCCTCTCTCGCCAGCTTGAAAATTGATAACTGCAACAAATTGGTGATTTTGCCAGAATGGTTGGAGAACCTACCTTTTCTACAGATAATGTGTTTGTCTGGCTGTCCAATTCTGCACTCCATTCCTGAAGGCCTAACATGTAGCGACATTATTGTTGAATATTGCCCCAATTTTAAAGAACCATCAGGTATGTCATCAGTGCTCTGTTCATGGAAAGCCATGTTTCTGATTTTCATTGAGCTATTCTTAAAGCAATTGAACTAG


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein NBS-LRR disease resistance protein [Oryza rufipogon].

MPHAMGQLINLHTLLGYFVPNNGSSAMSELQSLPDLNRLSLVNLEKVSDTEDARMAKLQEKEKLETLMLRWNMDAGNASRIDYEVLETLQPSQCLKTLEIVAYEGHVFPSWITSTEPYLTSLVEIRLVNLRSCENALPPLGLLPCLKIVEISRVDNISCIDDNFYGHNGTFPSLEKLILSFMTSLEVWEQSSRMNLFPRLAELVIIQCPKLRALHMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDRLKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLVILPEWLENLPFLQIMCLSGCPILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-230 SSF52058,LRR

MPHAMGQLINLHTLLGYFVPNNGSSAMSELQSLPDLNRLSLVNLEKVSDTEDARMAKLQEKEKLETLMLRWNMDAGNASRIDYEVLETLQPSQCLKTLEIVAYEGHVFPSWITSTEPYLTSLVEIRLVNLRSCENALPPLGLLPCLKIVEISRVDNISCIDDNFYGHNGTFPSLEKLILSFMTSLEVWEQSSRMNLFPRLAELVIIQCPKLRALHMEFPSIEKLILWMNN

HMMPanther: PTHR23155
1-373 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MPHAMGQLINLHTLLGYFVPNNGSSAMSELQSLPDLNRLSLVNLEKVSDTEDARMAKLQEKEKLETLMLRWNMDAGNASRIDYEVLETLQPSQCLKTLEIVAYEGHVFPSWITSTEPYLTSLVEIRLVNLRSCENALPPLGLLPCLKIVEISRVDNISCIDDNFYGHNGTFPSLEKLILSFMTSLEVWEQSSRMNLFPRLAELVIIQCPKLRALHMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDRLKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLVILPEWLENLPFLQIMCLSGCPILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFI

HMMPanther: PTHR23155:SF216
1-373 PTHR23155:SF216,OS11G0640600 PROTEIN

MPHAMGQLINLHTLLGYFVPNNGSSAMSELQSLPDLNRLSLVNLEKVSDTEDARMAKLQEKEKLETLMLRWNMDAGNASRIDYEVLETLQPSQCLKTLEIVAYEGHVFPSWITSTEPYLTSLVEIRLVNLRSCENALPPLGLLPCLKIVEISRVDNISCIDDNFYGHNGTFPSLEKLILSFMTSLEVWEQSSRMNLFPRLAELVIIQCPKLRALHMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDRLKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLVILPEWLENLPFLQIMCLSGCPILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFI

Gene3D: G3DSA:3.80.10.10
52-217 G3DSA:3.80.10.10

DARMAKLQEKEKLETLMLRWNMDAGNASRIDYEVLETLQPSQCLKTLEIVAYEGHVFPSWITSTEPYLTSLVEIRLVNLRSCENALPPLGLLPCLKIVEISRVDNISCIDDNFYGHNGTFPSLEKLILSFMTSLEVWEQSSRMNLFPRLAELVIIQCPKLRALHME

superfamily: SSF52047
159-336 SSF52047,LRR

CIDDNFYGHNGTFPSLEKLILSFMTSLEVWEQSSRMNLFPRLAELVIIQCPKLRALHMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDRLKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLVILPEWLENLPFLQIMCLSGCPILHSIP

Gene3D: G3DSA:3.80.10.10
218-337 G3DSA:3.80.10.10

FPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDRLKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLVILPEWLENLPFLQIMCLSGCPILHSIPE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox