PRGDB00062255 (Disease resistance protein RPP13, putative)

From PRG Wiki
Revision as of 14:20, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Disease resistance protein RPP13, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 255540550 (XM_002511294)
Gene Class NL
Domain Type NBS, LRR
Gene Species Ricinus communis

Comment?

Ricinus communis Disease resistance protein RPP13, putative, mRNA.

DNA Sequence

ATGGCAGAGGCTCTGGTTAAGTTCTTCTTACAGAGATTGGATTCTCAAGAGACTCAGATGGAGACCTTCGCTGGTCTCGATGATCAAATAGAAAGAATAAAGGGCTTACTCAGGGAGATTGCTGAGTTTTTTGGAGACAGAGGCAGTATAAGTCATGTTGCCTTTAGTACTTGGATCGACAAACTTAAAAAAATAGTCTCCGACATGGATGACCAAGTTGATGAGTTCATCATTCAGATAGATAGGCAAATTGGATCTGATAGGTTGGCATCCACAGAATGCTTCAGGATTGAGCTGCAGAAGAGTGAATCTAGTCTTTTTGAAACCATCCAGAGAATTAGAGAACTCAAAAATTCAACCGTCACAAAAGAAGAAAAAAGAGAGAAAGAAGATAGCAACGAACAATCCCATGGAAGGGAAGAAGGTAAGATGAGACTCAGTTCAAATACCATTGAAGGACCGAAGGAAGAAAATGAAGGTAACATGGAACAATTCCATGAACAGGAAGAAGGTCAGACATTGTCTGCATCTTCCTCTGTTCCATTCAAATTAAAATACGATAGCTTACCTTATTACCTTCAATCTTGTTTAATGTATTGTTGTATATTCCCAGAGAATTACTGGATAAACAAGGGGAAATTGATTCGGTTGTTGGTAGCCGAAGGCCTGACACAAGAAAAAACAGGGCAATTATTAGAGGATGTAGCAGAAGGCAATATAAATGAGCTGGTCAACCAGGGAATGCTTAAATTCAAGGAAGAGCACCCAGGGAGTAGACCTACATTTACAGTTTCTTCTCCTTACCGCAAGCTCCTTCATGAAAACTTTAAAACTGGTCATGCCAATTCAAATTCGACTATCCCCCATATAGCATGCCGCGTTTTAGCTTCAGATATGACAAAAATTGGGCACAGTTTGAACAATCTCCGACCTCGATCTTTGTTTTTGTTTGGGAATCAAGGACATTTTGATGGACATTGGCTGGATTTGACATGGGCAAAGTTTTTGCGGGTGCTTGATCTAGAAGATACCAAAATTAAGAGCTTACCAGATGAAGTGGGGGATTTGGTTCACCTGACTTATCTGGGCTTAAAACACTGCCAGGCAAATGAACTTCCTGCAAGACTTGGAAAACTACGAGCACTGCAGACTTTGGATATCAGATGGTGCTGGAAATTATCAGCAGTGTCACCTGATATCCTAAATCTTGCAGGACTAAGGCATCTCAAAATGTCTTGCATAAATGGTAGTGGGATGAAACTACCAGAGGGAATAGGTAGATTAAGAAACCTATTGACACTAACTGGTCTGTGTGCTGGAGGTGGCATTGCAGGAGAACTAGACAGGCTGACACAACTAACAAGACTGGGGGTAGCAGATGTTGCTGAAGAGAATGCCGCTCAGGTATATGCCGCCATTATAAAGATGCAAGGTCTTCTTTGCTTGTCTCTAGAAGCACACCATGCTTTCAACAAGCAACAACTTGTGCTCTTGGAGTTGTTCTCACCTCCACCTCTTCTTAGGAAACTTCGTTTAGAGGGTGCCCTAGAAAAGATACCTAGCTGGCTTGGTTCAATGGAAAAGCTTACAAAGCTAAGACTAGGTTTCTCTCATTTATCGGAGATCCCAATGTTAGTTCTTCAGATCCTACCTAATTTAAAAATATTAACCTTGTGGCATGCTTATGATACAAAGCAGCTCGGAAAAGAATTCTGCAAAGCTGGTGGATTTCCCAAGCTTGAGGTTCTCAGAATTGCTTCTTATGTTCTTGAGGAATGGACAGAGCTTGAAGAGGGAGCACTGCCAAGCTTACAATGCCTCCACTTCCACAACTGCTCGAGTCTAAGGATACTCCCTGAAGGTTTGCAATATGTCACTACTTTGAAGCAGTTGAAGCTGCTGCCTCTGCTCGATGAACATGCTGAAAGGTTAAAACCTGATGGTGGAGAGGAAAATTACAAGATCAGGCACATTGCAACCATATCATTTATCCCTATGTCTGTTTTGAGTTTGGTTTCCCACCCCTGCCACCAGACCCAAGAGGCATCTGAAGATTGA


Protein sequences

Name Description Sequence
Disease resistance protein RPP13, putative Disease resistance protein RPP13, putative [Ricinus communis].

MAEALVKFFLQRLDSQETQMETFAGLDDQIERIKGLLREIAEFFGDRGSISHVAFSTWIDKLKKIVSDMDDQVDEFIIQIDRQIGSDRLASTECFRIELQKSESSLFETIQRIRELKNSTVTKEEKREKEDSNEQSHGREEGKMRLSSNTIEGPKEENEGNMEQFHEQEEGQTLSASSSVPFKLKYDSLPYYLQSCLMYCCIFPENYWINKGKLIRLLVAEGLTQEKTGQLLEDVAEGNINELVNQGMLKFKEEHPGSRPTFTVSSPYRKLLHENFKTGHANSNSTIPHIACRVLASDMTKIGHSLNNLRPRSLFLFGNQGHFDGHWLDLTWAKFLRVLDLEDTKIKSLPDEVGDLVHLTYLGLKHCQANELPARLGKLRALQTLDIRWCWKLSAVSPDILNLAGLRHLKMSCINGSGMKLPEGIGRLRNLLTLTGLCAGGGIAGELDRLTQLTRLGVADVAEENAAQVYAAIIKMQGLLCLSLEAHHAFNKQQLVLLELFSPPPLLRKLRLEGALEKIPSWLGSMEKLTKLRLGFSHLSEIPMLVLQILPNLKILTLWHAYDTKQLGKEFCKAGGFPKLEVLRIASYVLEEWTELEEGALPSLQCLHFHNCSSLRILPEGLQYVTTLKQLKLLPLLDEHAERLKPDGGEENYKIRHIATISFIPMSVLSLVSHPCHQTQEASED

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
2-677 PTHR23155:SF121,SUBFAMILY NOT NAMED

AEALVKFFLQRLDSQETQMETFAGLDDQIERIKGLLREIAEFFGDRGSISHVAFSTWIDKLKKIVSDMDDQVDEFIIQIDRQIGSDRLASTECFRIELQKSESSLFETIQRIRELKNSTVTKEEKREKEDSNEQSHGREEGKMRLSSNTIEGPKEENEGNMEQFHEQEEGQTLSASSSVPFKLKYDSLPYYLQSCLMYCCIFPENYWINKGKLIRLLVAEGLTQEKTGQLLEDVAEGNINELVNQGMLKFKEEHPGSRPTFTVSSPYRKLLHENFKTGHANSNSTIPHIACRVLASDMTKIGHSLNNLRPRSLFLFGNQGHFDGHWLDLTWAKFLRVLDLEDTKIKSLPDEVGDLVHLTYLGLKHCQANELPARLGKLRALQTLDIRWCWKLSAVSPDILNLAGLRHLKMSCINGSGMKLPEGIGRLRNLLTLTGLCAGGGIAGELDRLTQLTRLGVADVAEENAAQVYAAIIKMQGLLCLSLEAHHAFNKQQLVLLELFSPPPLLRKLRLEGALEKIPSWLGSMEKLTKLRLGFSHLSEIPMLVLQILPNLKILTLWHAYDTKQLGKEFCKAGGFPKLEVLRIASYVLEEWTELEEGALPSLQCLHFHNCSSLRILPEGLQYVTTLKQLKLLPLLDEHAERLKPDGGEENYKIRHIATISFIPMSVLSLVSHPCH

HMMPanther: PTHR23155
2-677 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AEALVKFFLQRLDSQETQMETFAGLDDQIERIKGLLREIAEFFGDRGSISHVAFSTWIDKLKKIVSDMDDQVDEFIIQIDRQIGSDRLASTECFRIELQKSESSLFETIQRIRELKNSTVTKEEKREKEDSNEQSHGREEGKMRLSSNTIEGPKEENEGNMEQFHEQEEGQTLSASSSVPFKLKYDSLPYYLQSCLMYCCIFPENYWINKGKLIRLLVAEGLTQEKTGQLLEDVAEGNINELVNQGMLKFKEEHPGSRPTFTVSSPYRKLLHENFKTGHANSNSTIPHIACRVLASDMTKIGHSLNNLRPRSLFLFGNQGHFDGHWLDLTWAKFLRVLDLEDTKIKSLPDEVGDLVHLTYLGLKHCQANELPARLGKLRALQTLDIRWCWKLSAVSPDILNLAGLRHLKMSCINGSGMKLPEGIGRLRNLLTLTGLCAGGGIAGELDRLTQLTRLGVADVAEENAAQVYAAIIKMQGLLCLSLEAHHAFNKQQLVLLELFSPPPLLRKLRLEGALEKIPSWLGSMEKLTKLRLGFSHLSEIPMLVLQILPNLKILTLWHAYDTKQLGKEFCKAGGFPKLEVLRIASYVLEEWTELEEGALPSLQCLHFHNCSSLRILPEGLQYVTTLKQLKLLPLLDEHAERLKPDGGEENYKIRHIATISFIPMSVLSLVSHPCH

HMMPfam: PF00931
IPR002182
164-226 NB-ARC,NBS
NB-ARC

QFHEQEEGQTLSASSSVPFKLKYDSLPYYLQSCLMYCCIFPENYWINKGKLIRLLVAEGLTQE

superfamily: SSF52058
253-633 SSF52058,LRR

EEHPGSRPTFTVSSPYRKLLHENFKTGHANSNSTIPHIACRVLASDMTKIGHSLNNLRPRSLFLFGNQGHFDGHWLDLTWAKFLRVLDLEDTKIKSLPDEVGDLVHLTYLGLKHCQANELPARLGKLRALQTLDIRWCWKLSAVSPDILNLAGLRHLKMSCINGSGMKLPEGIGRLRNLLTLTGLCAGGGIAGELDRLTQLTRLGVADVAEENAAQVYAAIIKMQGLLCLSLEAHHAFNKQQLVLLELFSPPPLLRKLRLEGALEKIPSWLGSMEKLTKLRLGFSHLSEIPMLVLQILPNLKILTLWHAYDTKQLGKEFCKAGGFPKLEVLRIASYVLEEWTELEEGALPSLQCLHFHNCSSLRILPEGLQYVTTLKQLKL

Gene3D: G3DSA:3.80.10.10
312-434 G3DSA:3.80.10.10

RSLFLFGNQGHFDGHWLDLTWAKFLRVLDLEDTKIKSLPDEVGDLVHLTYLGLKHCQANELPARLGKLRALQTLDIRWCWKLSAVSPDILNLAGLRHLKMSCINGSGMKLPEGIGRLRNLLTL

Gene3D: G3DSA:3.80.10.10
447-633 G3DSA:3.80.10.10

LDRLTQLTRLGVADVAEENAAQVYAAIIKMQGLLCLSLEAHHAFNKQQLVLLELFSPPPLLRKLRLEGALEKIPSWLGSMEKLTKLRLGFSHLSEIPMLVLQILPNLKILTLWHAYDTKQLGKEFCKAGGFPKLEVLRIASYVLEEWTELEEGALPSLQCLHFHNCSSLRILPEGLQYVTTLKQLKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox