PRGDB00063267 (hypothetical protein)

From PRG Wiki
Revision as of 13:46, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 297819537 (XM_002877606)
Gene Class Unknown
Domain Type
Gene Species Arabidopsis lyrata subsp. lyrata

Comment?

Arabidopsis lyrata subsp. lyrata hypothetical protein, mRNA.

DNA Sequence

ATGACTTTCAATCATGATAATCACAAAATTGAGACAATTTGGAACCCTCCTACTCTTCCAAACCTGAGACAATTTGGTGTCCAGAACTGTCCAAAGCTTACTAGAGCTGCCACTAAGTGTCTGAGACAAGAACTCCAGTCGATGATGATGGTCAAGTTGAAGGCTGAAGCTCTCTGGCTGCTTGATTTTCTCACCCTATGTGTATTAGGATCTTCTCAGCACTAA


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein ARALYDRAFT_906189 [Arabidopsis lyrata subsp. lyrata].

MTFNHDNHKIETIWNPPTLPNLRQFGVQNCPKLTRAATKCLRQELQSMMMVKLKAEALWLLDFLTLCVLGSSQH







List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox