PRGDB00063364 (hypothetical protein)

From PRG Wiki
Revision as of 13:45, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 297335169 (GL348713)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis lyrata subsp. lyrata

Comment?

Arabidopsis lyrata subsp. lyrata unplaced genomic scaffold ARALYscaffold_1, whole genome shotgun sequence.

DNA Sequence

ATGGGAAACTGTGTATCACTAGACGTATCTTGTGATCAAACGTTGCATCACGCTTGTGGCTGCTTATTTGGTGATGGGAATTACATTCACATGATGGAGGCAAATCTTGAGGCTCTGGAGAAAACTATGCAAGAACTTGAAGAGAGACGAGATGATCTTTTAAGAAGAGTTGTCATTGACGAAGATAAAGGTTTGCAACGGCTTGCTCAAGTCCAAGGATGGTTTTCAAGGGTACAAAGTGTTGAGTCTCAAGTCAAAGATTTGCTCGAGGCTAGATCAACTCAAACTAAAAGATTGTGTCTGCTTGGATATTGCTCTAAGAAGTGCATAACAAGCTGGCTTCTAGCTAAAGGAGTTTTCCAAGTGGTGGCTGAGAAAATCCCTGTACCAAAGGTGGACAAGAAGCATTTTCAAACCACAGTTGGTTTGGATTCAATGGTTGAGAAGGCATGGAACAGCCTCATGATCGGTGAACGAAGAACACTGGGTCTTTATGGTATGGGGGGAGTCGGAAAAACTACCCTCTTAGCTTGTATCAACAACAGATTCCTCGAAGTGGTGAATGAATTTGATGTTGTGATCTGGGTTGTGGTCTCTAAAGATTTGCAAATTGAGAGCATCCAGAATCAGATTTTAGGAAGACTAAGTCTTGACAAGGAATGGAAACAAGAAACGGAAATTGAGAGAGCCTCTCATTTGAACAAGATAGGAGTTCCACCTCCAACCCAAGAAAATGGATCCAAATTAGTTTTTACGACTCGTTCTAAGGAAGTTTGCAAAGACATAGAGGTTGATGATATAATGGAAGTTGCTTGTTTGTCACCGGATGAAGCCTGGGAGTTATTTCAGCAAAAAGTTGGAGAAAACCCTATAAAGAGCCATCATGATTTTCTCCCAGTTGCAAGAAAAATTGCTGCAAAATGTTGTGGCTTGCCACTTGCGCTATGTGTCATTGGAAAAGCCATGGCATGTAAAGAGACTGTACAAGAATGGCGTCATGCGATTCATGTTCTCAACTCGTCTAGCCATGAGTTTCCAGATTATGAAATAGGGAAGGAGAAATTGATAAAATATTGGATATGCGAAGGATTTATCGATGGAAGCAGAAATGACGATGGAGCTGACAACCAAGGTCATGATATAATCGGTTTACTAGTTCATGCCCATCTATTGGTGGATGGTGTACTCACATTCACCGTGAAAATGCATGATGTTATACGCGAGATGGCTCTTTGGATAGCATCTAATTTTGGGAAACAGAGAGAAACATTTTGTGTTAGATCTGGTGCGCAGTTACGTGAAATACCAAAAGACATCAATTGGGAACTTGTGAGAAGGATATCACTAATGAGCAATCAGATTTCGGAGATATCTTGCAGTTGCAACTGCTCCAACCTTTCGACCCTATTATTCCAGAATAATAAGTTGGTGGATATTTCATGTGAATTCTTTCGGTTTATGCCAGCACTTGTGGTCTTGGATCTATCGAGGAACTCAATTCTTTCTAGGTTGCCGGAAGAAATTTCTAACTTGGGTTCCTTGCAATATCTCAACTTATCATACACAGGAATGAAATCGTTACCAGATGGTTTGAAGGAGATGAAACGACTAATCGACTTGAATTTGGAGTTTACTCGTGAGCTTGAAAGTATTGTTGGGATAGCAACAAGTCTACCAAATCTTCAAGTGTTGAGATTATATTGTTCCAGAGTTTGTGTTGATGACATATTAATGAAAGAGCTACAACTCTTGGAGCACGTGGAGATTGTGACAGCAACCATAGAGGATGCCGTGATTTTGAAAAATATACAAGGAGTGGACCGATTAGCAAGCAGTATTCGAGGTTTATGTCTCAGCAATATGTCAGCACCGGTGGTAATATTAAACACGGTAGTTGTGGGAGGTCTTCAACGCCTTACTATTTGGAACTCCAAAATCTCTGAGATAAAGATAGATTGGGAAAGCAAAGAAAGAGGGGATCTAATATGTACAGGTTCTCCAGGCTTCAAGCAACTCTCCGCTGTACATATAGTCCGTTTGGAAGGTCCAACCGATTTGACATGGCTATTGTATGCTCAAAGTCTCAGGATTCTATCTGTGTCGGGTCCATCAAGTATAGAAGAAATAATAAATAGAGAGAAAGAAATGAGTATTAGGACGTTGCATCCAGATATTGTTGTGCCTTTCGAAGAGCTGGAGAGCATGTAA


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein ARALYDRAFT_888984 [Arabidopsis lyrata subsp. lyrata].

MGNCVSLDVSCDQTLHHACGCLFGDGNYIHMMEANLEALEKTMQELEERRDDLLRRVVIDEDKGLQRLAQVQGWFSRVQSVESQVKDLLEARSTQTKRLCLLGYCSKKCITSWLLAKGVFQVVAEKIPVPKVDKKHFQTTVGLDSMVEKAWNSLMIGERRTLGLYGMGGVGKTTLLACINNRFLEVVNEFDVVIWVVVSKDLQIESIQNQILGRLSLDKEWKQETEIERASHLNKIGVPPPTQENGSKLVFTTRSKEVCKDIEVDDIMEVACLSPDEAWELFQQKVGENPIKSHHDFLPVARKIAAKCCGLPLALCVIGKAMACKETVQEWRHAIHVLNSSSHEFPDYEIGKEKLIKYWICEGFIDGSRNDDGADNQGHDIIGLLVHAHLLVDGVLTFTVKMHDVIREMALWIASNFGKQRETFCVRSGAQLREIPKDINWELVRRISLMSNQISEISCSCNCSNLSTLLFQNNKLVDISCEFFRFMPALVVLDLSRNSILSRLPEEISNLGSLQYLNLSYTGMKSLPDGLKEMKRLIDLNLEFTRELESIVGIATSLPNLQVLRLYCSRVCVDDILMKELQLLEHVEIVTATIEDAVILKNIQGVDRLASSIRGLCLSNMSAPVVILNTVVVGGLQRLTIWNSKISEIKIDWESKERGDLICTGSPGFKQLSAVHIVRLEGPTDLTWLLYAQSLRILSVSGPSSIEEIINREKEMSIRTLHPDIVVPFEELESM

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-733 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MGNCVSLDVSCDQTLHHACGCLFGDGNYIHMMEANLEALEKTMQELEERRDDLLRRVVIDEDKGLQRLAQVQGWFSRVQSVESQVKDLLEARSTQTKRLCLLGYCSKKCITSWLLAKGVFQVVAEKIPVPKVDKKHFQTTVGLDSMVEKAWNSLMIGERRTLGLYGMGGVGKTTLLACINNRFLEVVNEFDVVIWVVVSKDLQIESIQNQILGRLSLDKEWKQETEIERASHLNKIGVPPPTQENGSKLVFTTRSKEVCKDIEVDDIMEVACLSPDEAWELFQQKVGENPIKSHHDFLPVARKIAAKCCGLPLALCVIGKAMACKETVQEWRHAIHVLNSSSHEFPDYEIGKEKLIKYWICEGFIDGSRNDDGADNQGHDIIGLLVHAHLLVDGVLTFTVKMHDVIREMALWIASNFGKQRETFCVRSGAQLREIPKDINWELVRRISLMSNQISEISCSCNCSNLSTLLFQNNKLVDISCEFFRFMPALVVLDLSRNSILSRLPEEISNLGSLQYLNLSYTGMKSLPDGLKEMKRLIDLNLEFTRELESIVGIATSLPNLQVLRLYCSRVCVDDILMKELQLLEHVEIVTATIEDAVILKNIQGVDRLASSIRGLCLSNMSAPVVILNTVVVGGLQRLTIWNSKISEIKIDWESKERGDLICTGSPGFKQLSAVHIVRLEGPTDLTWLLYAQSLRILSVSGPSSIEEIINREKEMSIRTLHPDIVVPFEELE

HMMPanther: PTHR23155:SF113
1-733 PTHR23155:SF113,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

MGNCVSLDVSCDQTLHHACGCLFGDGNYIHMMEANLEALEKTMQELEERRDDLLRRVVIDEDKGLQRLAQVQGWFSRVQSVESQVKDLLEARSTQTKRLCLLGYCSKKCITSWLLAKGVFQVVAEKIPVPKVDKKHFQTTVGLDSMVEKAWNSLMIGERRTLGLYGMGGVGKTTLLACINNRFLEVVNEFDVVIWVVVSKDLQIESIQNQILGRLSLDKEWKQETEIERASHLNKIGVPPPTQENGSKLVFTTRSKEVCKDIEVDDIMEVACLSPDEAWELFQQKVGENPIKSHHDFLPVARKIAAKCCGLPLALCVIGKAMACKETVQEWRHAIHVLNSSSHEFPDYEIGKEKLIKYWICEGFIDGSRNDDGADNQGHDIIGLLVHAHLLVDGVLTFTVKMHDVIREMALWIASNFGKQRETFCVRSGAQLREIPKDINWELVRRISLMSNQISEISCSCNCSNLSTLLFQNNKLVDISCEFFRFMPALVVLDLSRNSILSRLPEEISNLGSLQYLNLSYTGMKSLPDGLKEMKRLIDLNLEFTRELESIVGIATSLPNLQVLRLYCSRVCVDDILMKELQLLEHVEIVTATIEDAVILKNIQGVDRLASSIRGLCLSNMSAPVVILNTVVVGGLQRLTIWNSKISEIKIDWESKERGDLICTGSPGFKQLSAVHIVRLEGPTDLTWLLYAQSLRILSVSGPSSIEEIINREKEMSIRTLHPDIVVPFEELE

superfamily: SSF52540
122-333 SSF52540

VVAEKIPVPKVDKKHFQTTVGLDSMVEKAWNSLMIGERRTLGLYGMGGVGKTTLLACINNRFLEVVNEFDVVIWVVVSKDLQIESIQNQILGRLSLDKEWKQETEIERASHLNKIGVPPPTQENGSKLVFTTRSKEVCKDIEVDDIMEVACLSPDEAWELFQQKVGENPIKSHHDFLPVARKIAAKCCGLPLALCVIGKAMACKETVQEWRH

Gene3D: G3DSA:3.40.50.300
128-165 G3DSA:3.40.50.300

PVPKVDKKHFQTTVGLDSMVEKAWNSLMIGERRTLGLY

HMMPfam: PF00931
IPR002182
144-228 NB-ARC,NBS
NB-ARC

DSMVEKAWNSLMIGERRTLGLYGMGGVGKTTLLACINNRFLEVVNEFDVVIWVVVSKDLQIESIQNQILGRLSLDKEWKQETEIE

FPrintScan: PR00364
IPR000767
161-176 DISEASERSIST
Disease resistance protein

TLGLYGMGGVGKTTLL

Gene3D: G3DSA:3.40.50.300
166-180 G3DSA:3.40.50.300

GMGGVGKTTLLACIN

Gene3D: G3DSA:3.40.50.300
181-225 G3DSA:3.40.50.300

NRFLEVVNEFDVVIWVVVSKDLQIESIQNQILGRLSLDKEWKQET

HMMPfam: PF00931
IPR002182
231-344 NB-ARC,NBS
NB-ARC

SHLNKIGVPPPTQENGSKLVFTTRSKEVCKDIEVDDIMEVACLSPDEAWELFQQKVGENPIKSHHDFLPVARKIAAKCCGLPLALCVIGKAMACKETVQEWRHAIHVLNSSSHE

FPrintScan: PR00364
IPR000767
308-322 DISEASERSIST
Disease resistance protein

CCGLPLALCVIGKAM

superfamily: SSF52058
410-724 SSF52058,LRR

ALWIASNFGKQRETFCVRSGAQLREIPKDINWELVRRISLMSNQISEISCSCNCSNLSTLLFQNNKLVDISCEFFRFMPALVVLDLSRNSILSRLPEEISNLGSLQYLNLSYTGMKSLPDGLKEMKRLIDLNLEFTRELESIVGIATSLPNLQVLRLYCSRVCVDDILMKELQLLEHVEIVTATIEDAVILKNIQGVDRLASSIRGLCLSNMSAPVVILNTVVVGGLQRLTIWNSKISEIKIDWESKERGDLICTGSPGFKQLSAVHIVRLEGPTDLTWLLYAQSLRILSVSGPSSIEEIINREKEMSIRTLHPD

Gene3D: G3DSA:3.80.10.10
428-560 G3DSA:3.80.10.10

SGAQLREIPKDINWELVRRISLMSNQISEISCSCNCSNLSTLLFQNNKLVDISCEFFRFMPALVVLDLSRNSILSRLPEEISNLGSLQYLNLSYTGMKSLPDGLKEMKRLIDLNLEFTRELESIVGIATSLPN

HMMPfam: PF13855
464-522 LRR_8,Leucine rich repeat

SNLSTLLFQNNKLVDISCEFFRFMPALVVLDLSRNSILSRLPEEISNLGSLQYLNLSYT

FPrintScan: PR00364
IPR000767
485-501 DISEASERSIST
Disease resistance protein

RFMPALVVLDLSRNSIL

Gene3D: G3DSA:3.40.50.300
561-604 G3DSA:3.40.50.300

LQVLRLYCSRVCVDDILMKELQLLEHVEIVTATIEDAVILKNIQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox