PRGDB00063441 (disease resistance-like protein)

From PRG Wiki
Revision as of 13:42, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
disease resistance-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 13310472 (AF338972)
Gene Class CNL
Domain Type NBS, LRR
Gene Species Brassica rapa

Comment?

Brassica rapa cultivar R500 disease resistance-like protein (RGA8) gene, partial cds.

DNA Sequence

GATCTCTGGTAAGCTCGATGTTGTGATCTGGATCGTGGTGTCTCAAGGTGCAAGTATCTCGAAGCTTCAAGAAGATATTGCACAGAAGCTACGTCTTTGCGAYGACCAGTGGACACGGAAAGATGAAAGTGATAAGGCCGCGGAGATGCATAGAGTTTTAAARGGGACGCGGTTTGTTTTGRTGCTTGATGACATATGGGAGAAAGTTGATTTAGAAGCCATCGGAGTTCCGGAACCGACTAGAGAAAATGGATGCAAAGTAGCATTCACCACGCGTTCTAAGGAAGTATGTGGGAGGATGGGGGATCATGAACCGATGCAAGTCCAGTGTTTGGARCGNGATCAAGCGTGGAG


Protein sequences

Name Description Sequence
disease resistance-like protein disease resistance-like protein [Brassica rapa].

ISGKLDVVIWIVVSQGASISKLQEDIAQKLRLCDDQWTRKDESDKAAEMHRVLKGTRFVLXLDDIWEKVDLEAIGVPEPTRENGCKVAFTTRSKEVCGRMGDHEPMQVQCLERDQAW

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF117
1-87 PTHR23155:SF117,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

ISGKLDVVIWIVVSQGASISKLQEDIAQKLRLCDDQWTRKDESDKAAEMHRVLKGTRFVLXLDDIWEKVDLEAIGVPEPTRENGCKV

HMMPanther: PTHR23155
1-87 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ISGKLDVVIWIVVSQGASISKLQEDIAQKLRLCDDQWTRKDESDKAAEMHRVLKGTRFVLXLDDIWEKVDLEAIGVPEPTRENGCKV

HMMPfam: PF00931
IPR002182
2-117 NB-ARC,NBS
NB-ARC

SGKLDVVIWIVVSQGASISKLQEDIAQKLRLCDDQWTRKDESDKAAEMHRVLKGTRFVLXLDDIWEKVDLEAIGVPEPTRENGCKVAFTTRSKEVCGRMGDHEPMQVQCLERDQAW


List of References

M Fourmann, F Chariot, N Froger, R Delourme, D Brunel
Expression, mapping, and genetic variability of Brassica napus disease resistance gene analogues.
Genome: 2001, 44(6);1083-99
PubMed:11768212 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox