PRGDB00063858 (hypothetical protein)

From PRG Wiki
Revision as of 13:27, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 195650450 (EU972575)
Gene Class Unknown
Domain Type
Gene Species Zea mays

Comment?

Zea mays clone 383792 hypothetical protein mRNA, complete cds.

DNA Sequence

ATGGCCACGGCCGCGAGGCTGCCTACGGTTCCACCGTCGGCTGCGGCGGGAGATGTCTCCGAGGTGGAGCTCTCGGAGGCGGGATCGCCGGACCTCGGCAGCCGGAGCAGCGGTAGCGGTAGCGGGGGCAGCGGCCGGAGCACGGCGGAGTACTCCGGGTGGGTGTACCACCTCGGCGTAAACTCCATCGGCCACGAGTACTGCCACCTCCGCTTCCTCGTCATCCGCGCCAAATTCGTCGCCATGTACAAGCGGGACCCGCACGACAACCCGGGACTCGTCGGTTTCCCCGATCCATTGCACTCTTCCCTCCCTCTGTTTTGTTTCTGA


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein [Zea mays].

MATAARLPTVPPSAAAGDVSEVELSEAGSPDLGSRSSGSGSGGSGRSTAEYSGWVYHLGVNSIGHEYCHLRFLVIRAKFVAMYKRDPHDNPGLVGFPDPLHSSLPLFCF



List of References

Nickolai N Alexandrov, Vyacheslav V Brover, Stanislav Freidin, Maxim E Troukhan, Tatiana V Tatarinova, Hongyu Zhang, Timothy J Swaller, Yu-Ping Lu, John Bouck, Richard B Flavell, Kenneth A Feldmann
Insights into corn genes derived from large-scale cDNA sequencing.
Plant Mol. Biol.: 2009, 69(1-2);179-94
PubMed:18937034 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox