PRGDB00063886 (Zm.243)

From PRG Wiki
Revision as of 13:26, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Zm.243
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 3445396 (AJ010166)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays mRNA for S-domain receptor-like protein kinase

DNA Sequence

ATGGCTCCTGTCTTCTTCCTTCTACCTCTCCTACTCGGCCAGATCCTTCTCTGCGCAGCCGGCGACACCATCAACTCGTCCACACCCTTGTCCGGCGCGCAGAAGATTGTGTCCAAGGGCAACAAGTTCACCTTGGGCTTCTACACCCCACCCCAAGGTACCAACACCTCCTCCAACCAGGGTAACTATTACATCGCCATATGGTACAGCAACATACCACTGCAGACGACGGTGTGGATGGCCAACCCCGATCTGCCGGTGGCTGACCCGACCACCGCCGCCTTGACCATCGGCAGCGACGGCAACCTCGTCCTCCTTGATCAATCCAAGAATCGGCAGGTGCTGTGGTCGACGAACATAAGTACTAGCTCCAATTCCACCATCGCTGTCCTCCAGGACGGCGGTAGCCTCGACCTCAGAGATGCCACCAATTCATCCATGGTTTATTGGCGAAGCATCGATCATCCCACCAATACCTGGCTTCCTGGGGGCAAGCTTGGGCTGAACAAGACCACTGGTGTGAGCCAGCGGCTTGTTCCATGGACTAACACCGCCAACCCCTCTCCTGGGCTGTTCTCACTGGAGTTGGATCCAAGAGGCACGACGCAATACTTAATTCAGTGGAATGATTCCATAACATACTGGAGCAGTGGTCCTTGGAATAATAACATCTTTAGCCTTGTGCCAGAGATGACCTCTGGTTACAACTATGACTTCCAGTTCATCAACAATGCCACCGAGAGCTACTTCATCTACTCAATGAAGGACAACAGCATCATCTCGAGGTTCATCATCGATGTGGATGGGCAGATCAAGCAGCTGACATGGGTGCCTGCCTCCCAGTCATGGATCTTGTTCTGGTCCCAGCCAAGGACACAGTGTGAGGTGTACGCACTGTGTGGGGCCTATGGTAGCTGCAACCTCAATGCACTGCCATTCTGCAACTGCATCAGGGGGTTCAGCCAGAAGGTTCAGAGTGATTGGGACCTCCAGGATTACAGTAGCGGGTGCAAAAGGAGAGTACCATTGCAGTGCCAGACCAATTCGAGCTCTTCACAGGCTCAGCCTGATAAGTTCTATACCATGGCAAATGTGAGGCTACCTGATAATGCTCAGACTGCTGTGGCTGCGAGCTCTCAAGACTGTCAAGTGGCTTGTCTGAACAATTGCTCCTGTAATGCATATACTTATAATAGTAGTGGCTGCTTTGCTTGGCATGGGGATCTGATTAACCTTCAGGATCAATACAGCGGGAATGGAGGAGGCACACTCTTCCTCAGGCTTGCGGCTTCTGAACTGCCAGGCTCCAAAAGGAGCAAGGCAGTGATCATTGGTGCAGTTGTTGGCGGAGTTGCTGCAGTTTTAATTGTCCTTTCTATTGTGGCATACTTCCTATTTCAGAAATACCGCCGAGAGAGGACTCTCAGGATACCCAAGACTGCTGGGGGCACACTGATCGCCTTTAGATACAGTGATCTGCAGCATGTCACTAATAACTTCTCGGAGAGGCTGGGTGGAGGTGCCTTTGGCTCGGTGTTCAAAGGGAAGCTCCCAGATTCAACAGCCATTGCTGTGAAGAGGCTCGATGGAGTTCACCAAGGGGAGAAGCAATTTCGTGCTGAGGTGAGCACCATTGGCACCGTACAGCATGTTAATTTGGTCCGCCTCCTTGGATTTTGCTCAGAAGGATCACGGAGGCTGCTTGTGTATGAGTTCATGCCAAAGGGCTCCCTGGACCTGCAGCTATTCCTTGGTGAGACAACAGCACTCAGCTGGGCTACCAGGTACCAAATAGCACTTGGAACAGCAAGGGGCTTAAATTACCTGCATGAAAAATGTAGGGATTGCATTATACACTGTGATGTCAAGCCAGAAAACATACTCTTGGATGAGTCATTTGTGCCTAAGGTGGCTGATTTTGGTCTAGCAAAGCTCTTAGGCAGAGACTTCAGCCGTGTATTGACAACAATGAGAGGAACAAGGGGTTACCTTGCGCCTGAATGGATCAGTGGTGTGGCAATTACAGCAAAGGCAGATGTCTTTAGCTATGGCATGATGCTCTTCGAACTCATATCAGGCAGGAGAAATTCTGACCACGGAGAACAGCATGGATCCACCTTTTTCCCAACCTTTGCTGCCAGCAAGCTTCATGAAGGAGATGTGCGGACCTTGTTGGACCCCAAGCTGAATGGAGATGCAAATGCTGACGAACTCACAAGAGCTTGTAAGGTTGCCTGTTGGTGCATCCAAGATGACGAAAGTGCTAGACCTACAACTGGTCAGATTGTTCAAATCCTCGAGGGATTCCTTGACGTTAACATGCCTCCTGTTCCAAGGTCATTGAGAGTTCTTGGTGAAAGCCCTGATGTTATAAACTTCTTTTCAGATATATCTTCAAACCAGACTTCCCAGACACAGAACAGCACAACTTCCCAGACACGCAGTACTACTTCAGGCAGTTCACATCTCCAAAGTCCATAGATCAGATAACCTGCAATTTATTAGGGCAATACTTGAAGAGCATGAGTAAATCTGTACATGATTAGAACCTAATATACTCAGTTTTTGTATCACTATGCTTCAGTACTGTAAATTTAGTGCAGAATGTCATaaaaaaaaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.243 translated coding region predicted by ESTScan from UniGene Zm.243

MAPVFFLLPLLLGQILLCAAGDTINSSTPLSGAQKIVSKGNKFTLGFYTPPQGTNTSSNQGNYYIAIWYSNIPLQTTVWMANPDLPVADPTTAALTIGSDGNLVLLDQSKNRQVLWSTNISTSSNSTIAVLQDGGSLDLRDATNSSMVYWRSIDHPTNTWLPGGKLGLNKTTGVSQRLVPWTNTANPSPGLFSLELDPRGTTQYLIQWNDSITYWSSGPWNNNIFSLVPEMTSGYNYDFQFINNATESYFIYSMKDNSIISRFIIDVDGQIKQLTWVPASQSWILFWSQPRTQCEVYALCGAYGSCNLNALPFCNCIRGFSQKVQSDWDLQDYSSGCKRRVPLQCQTNSSSSQAQPDKFYTMANVRLPDNAQTAVAASSQDCQVACLNNCSCNAYTYNSSGCFAWHGDLINLQDQYSGNGGGTLFLRLAASELPGSKRSKAVIIGAVVGGVAAVLIVLSIVAYFLFQKYRRERTLRIPKTAGGTLIAFRYSDLQHVTNNFSERLGGGAFGSVFKGKLPDSTAIAVKRLDGVHQGEKQFRAEVSTIGTVQHVNLVRLLGFCSEGSRRLLVYEFMPKGSLDLQLFLGETTALSWATRYQIALGTARGLNYLHEKCRDCIIHCDVKPENILLDESFVPKVADFGLAKLLGRDFSRVLTTMRGTRGYLAPEWISGVAITAKADVFSYGMMLFELISGRRNSDHGEQHGSTFFPTFAASKLHEGDVRTLLDPKLNGDANADELTRACKVACWCIQDDESARPTTGQIVQILEGFLDVNMPPVPRSLRVLGESPDVINFFSDXIFKPDFPDTEQHNFPDTQYYFRQFTSPKSIDQITCNLLGQYLKSMSKSVHD

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF442
1-834 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MAPVFFLLPLLLGQILLCAAGDTINSSTPLSGAQKIVSKGNKFTLGFYTPPQGTNTSSNQGNYYIAIWYSNIPLQTTVWMANPDLPVADPTTAALTIGSDGNLVLLDQSKNRQVLWSTNISTSSNSTIAVLQDGGSLDLRDATNSSMVYWRSIDHPTNTWLPGGKLGLNKTTGVSQRLVPWTNTANPSPGLFSLELDPRGTTQYLIQWNDSITYWSSGPWNNNIFSLVPEMTSGYNYDFQFINNATESYFIYSMKDNSIISRFIIDVDGQIKQLTWVPASQSWILFWSQPRTQCEVYALCGAYGSCNLNALPFCNCIRGFSQKVQSDWDLQDYSSGCKRRVPLQCQTNSSSSQAQPDKFYTMANVRLPDNAQTAVAASSQDCQVACLNNCSCNAYTYNSSGCFAWHGDLINLQDQYSGNGGGTLFLRLAASELPGSKRSKAVIIGAVVGGVAAVLIVLSIVAYFLFQKYRRERTLRIPKTAGGTLIAFRYSDLQHVTNNFSERLGGGAFGSVFKGKLPDSTAIAVKRLDGVHQGEKQFRAEVSTIGTVQHVNLVRLLGFCSEGSRRLLVYEFMPKGSLDLQLFLGETTALSWATRYQIALGTARGLNYLHEKCRDCIIHCDVKPENILLDESFVPKVADFGLAKLLGRDFSRVLTTMRGTRGYLAPEWISGVAITAKADVFSYGMMLFELISGRRNSDHGEQHGSTFFPTFAASKLHEGDVRTLLDPKLNGDANADELTRACKVACWCIQDDESARPTTGQIVQILEGFLDVNMPPVPRSLRVLGESPDVINFFSDXIFKPDFPDTEQHNFPDTQYYFRQFTSPKSIDQITCNL

HMMPanther: PTHR24420
1-834 FAMILY NOT NAMED,FAMILY NOT NAMED

MAPVFFLLPLLLGQILLCAAGDTINSSTPLSGAQKIVSKGNKFTLGFYTPPQGTNTSSNQGNYYIAIWYSNIPLQTTVWMANPDLPVADPTTAALTIGSDGNLVLLDQSKNRQVLWSTNISTSSNSTIAVLQDGGSLDLRDATNSSMVYWRSIDHPTNTWLPGGKLGLNKTTGVSQRLVPWTNTANPSPGLFSLELDPRGTTQYLIQWNDSITYWSSGPWNNNIFSLVPEMTSGYNYDFQFINNATESYFIYSMKDNSIISRFIIDVDGQIKQLTWVPASQSWILFWSQPRTQCEVYALCGAYGSCNLNALPFCNCIRGFSQKVQSDWDLQDYSSGCKRRVPLQCQTNSSSSQAQPDKFYTMANVRLPDNAQTAVAASSQDCQVACLNNCSCNAYTYNSSGCFAWHGDLINLQDQYSGNGGGTLFLRLAASELPGSKRSKAVIIGAVVGGVAAVLIVLSIVAYFLFQKYRRERTLRIPKTAGGTLIAFRYSDLQHVTNNFSERLGGGAFGSVFKGKLPDSTAIAVKRLDGVHQGEKQFRAEVSTIGTVQHVNLVRLLGFCSEGSRRLLVYEFMPKGSLDLQLFLGETTALSWATRYQIALGTARGLNYLHEKCRDCIIHCDVKPENILLDESFVPKVADFGLAKLLGRDFSRVLTTMRGTRGYLAPEWISGVAITAKADVFSYGMMLFELISGRRNSDHGEQHGSTFFPTFAASKLHEGDVRTLLDPKLNGDANADELTRACKVACWCIQDDESARPTTGQIVQILEGFLDVNMPPVPRSLRVLGESPDVINFFSDXIFKPDFPDTEQHNFPDTQYYFRQFTSPKSIDQITCNL

Seg: seg
7-17 seg

LLPLLLGQILL

ProfileScan: PS50927
IPR001480
21-152 BULB_LECTIN
Bulb-type lectin domain

GDTINSSTPLSGAQKIVSKGNKFTLGFYTPPQGTNTSSNQGNYYIAIWYSNIPLQTTVWMANPDLPVADPTTAALTIGSDGNLVLLDQSKNRQVLWSTNISTSSNSTIAVLQDGGSLDLRDATNSSMVYWRS

HMMSmart: SM00108
IPR001480
21-156 Bulb-type mannose-specific lectin
Bulb-type lectin domain

GDTINSSTPLSGAQKIVSKGNKFTLGFYTPPQGTNTSSNQGNYYIAIWYSNIPLQTTVWMANPDLPVADPTTAALTIGSDGNLVLLDQSKNRQVLWSTNISTSSNSTIAVLQDGGSLDLRDATNSSMVYWRSIDHP

superfamily: SSF51110
IPR001480
62-221 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

NYYIAIWYSNIPLQTTVWMANPDLPVADPTTAALTIGSDGNLVLLDQSKNRQVLWSTNISTSSNSTIAVLQDGGSLDLRDATNSSMVYWRSIDHPTNTWLPGGKLGLNKTTGVSQRLVPWTNTANPSPGLFSLELDPRGTTQYLIQWNDSITYWSSGPWN

HMMPfam: PF01453
IPR001480
75-188 B_lectin
Bulb-type lectin domain

QTTVWMANPDLPVADPTTAALTIGSDGNLVLLDQSKNRQVLWSTNISTSSNSTIAVLQDGGSLDLRDATNSSMVYWRSIDHPTNTWLPGGKLGLNKTTGVSQRLVPWTNTANPS

Seg: seg
117-128 seg

STNISTSSNSTI

Gene3D: G3DSA:2.90.10.10
IPR001480
189-226 no description
Bulb-type lectin domain

PGLFSLELDPRGTTQYLIQWNDSITYWSSGPWNNNIFS

HMMPfam: PF00954
IPR000858
215-323 S_locus_glycop
S-locus glycoprotein

WSSGPWNNNIFSLVPEMTSGYNYDFQFINNATESYFIYSMKDNSIISRFIIDVDGQIKQLTWVPASQSWILFWSQPRTQCEVYALCGAYGSCNLNALPFCNCIRGFSQK

ProfileScan: PS50948
IPR003609
345-429 PAN
Apple-like

CQTNSSSSQAQPDKFYTMANVRLPDNAQTAVAASSQDCQVACLNNCSCNAYTYNSSGCFAWHGDLINLQDQYSGNGGGTLFLRLA

HMMPfam: PF08276
IPR013227
354-412 PAN_2
PAN-2 domain

AQPDKFYTMANVRLPDNAQTAVAASSQDCQVACLNNCSCNAYTYNSSGCFAWHGDLINL

HMMSmart: SM00473
IPR003609
354-428 divergent subfamily of APPLE domains
Apple-like

AQPDKFYTMANVRLPDNAQTAVAASSQDCQVACLNNCSCNAYTYNSSGCFAWHGDLINLQDQYSGNGGGTLFLRL

Seg: seg
441-462 seg

AVIIGAVVGGVAAVLIVLSIVA

Gene3D: G3DSA:3.30.200.20
484-560 no description

TLIAFRYSDLQHVTNNFSERLGGGAFGSVFKGKLPDSTAIAVKRLDGVHQGEKQFRAEVSTIGTVQHVNLVRLLGFC

superfamily: SSF56112
IPR011009
486-791 Protein kinase-like (PK-like)
Protein kinase-like domain

IAFRYSDLQHVTNNFSERLGGGAFGSVFKGKLPDSTAIAVKRLDGVHQGEKQFRAEVSTIGTVQHVNLVRLLGFCSEGSRRLLVYEFMPKGSLDLQLFLGETTALSWATRYQIALGTARGLNYLHEKCRDCIIHCDVKPENILLDESFVPKVADFGLAKLLGRDFSRVLTTMRGTRGYLAPEWISGVAITAKADVFSYGMMLFELISGRRNSDHGEQHGSTFFPTFAASKLHEGDVRTLLDPKLNGDANADELTRACKVACWCIQDDESARPTTGQIVQILEGFLDVNMPPVPRSLRVLGESPDVI

ProfileScan: PS50011
IPR000719
498-770 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

NNFSERLGGGAFGSVFKGKLPDSTAIAVKRLDGVHQGEKQFRAEVSTIGTVQHVNLVRLLGFCSEGSRRLLVYEFMPKGSLDLQLFLGETTALSWATRYQIALGTARGLNYLHEKCRDCIIHCDVKPENILLDESFVPKVADFGLAKLLGRDFSRVLTTMRGTRGYLAPEWISGVAITAKADVFSYGMMLFELISGRRNSDHGEQHGSTFFPTFAASKLHEGDVRTLLDPKLNGDANADELTRACKVACWCIQDDESARPTTGQIVQILEGFL

HMMSmart: SM00220
IPR002290
498-770 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

NNFSERLGGGAFGSVFKGKLPDSTAIAVKRLDGVHQGEKQFRAEVSTIGTVQHVNLVRLLGFCSEGSRRLLVYEFMPKGSLDLQLFLGETTALSWATRYQIALGTARGLNYLHEKCRDCIIHCDVKPENILLDESFVPKVADFGLAKLLGRDFSRVLTTMRGTRGYLAPEWISGVAITAKADVFSYGMMLFELISGRRNSDHGEQHGSTFFPTFAASKLHEGDVRTLLDPKLNGDANADELTRACKVACWCIQDDESARPTTGQIVQILEGFL

HMMSmart: SM00219
IPR020635
498-766 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

NNFSERLGGGAFGSVFKGKLPDSTAIAVKRLDGVHQGEKQFRAEVSTIGTVQHVNLVRLLGFCSEGSRRLLVYEFMPKGSLDLQLFLGETTALSWATRYQIALGTARGLNYLHEKCRDCIIHCDVKPENILLDESFVPKVADFGLAKLLGRDFSRVLTTMRGTRGYLAPEWISGVAITAKADVFSYGMMLFELISGRRNSDHGEQHGSTFFPTFAASKLHEGDVRTLLDPKLNGDANADELTRACKVACWCIQDDESARPTTGQIVQIL

HMMPfam: PF00069
IPR017442
501-764 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

SERLGGGAFGSVFKGKLPDSTAIAVKRLDGVHQGEKQFRAEVSTIGTVQHVNLVRLLGFCSEGSRRLLVYEFMPKGSLDLQLFLGETTALSWATRYQIALGTARGLNYLHEKCRDCIIHCDVKPENILLDESFVPKVADFGLAKLLGRDFSRVLTTMRGTRGYLAPEWISGVAITAKADVFSYGMMLFELISGRRNSDHGEQHGSTFFPTFAASKLHEGDVRTLLDPKLNGDANADELTRACKVACWCIQDDESARPTTGQIVQ

PatternScan: PS00107
IPR017441
504-526 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGGGAFGSVFKGKLPDSTAIAVK

Gene3D: G3DSA:1.10.510.10
561-764 no description

SEGSRRLLVYEFMPKGSLDLQLFLGETTALSWATRYQIALGTARGLNYLHEKCRDCIIHCDVKPENILLDESFVPKVADFGLAKLLGRDFSRVLTTMRGTRGYLAPEWISGVAITAKADVFSYGMMLFELISGRRNSDHGEQHGSTFFPTFAASKLHEGDVRTLLDPKLNGDANADELTRACKVACWCIQDDESARPTTGQIVQ

PatternScan: PS00108
IPR008271
617-629 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHCDVKPENILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox