PRGDB00063890 (Zm.359)

From PRG Wiki
Revision as of 13:26, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Zm.359
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 2735016 (U82481)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Zea mays

Comment?

Zea mays KI domain interacting kinase 1 (KIK1) mRNA, complete cds

DNA Sequence

CATGGTCTCCTCTCCTCGGCTCCTCTTCCTGCTCCTCGCCGGCGCCTCGCTATGCTGTGTGGCGGCGCAGAAGACGGACACGCTGCGGCAGGGGGAGTCGCTGTCCGGGGCGGCGACGCTGGTGTCCTCGCCGGAGGGGGTGTTCGAGGCGGGCTTCTTCGCGCCGGACCCCAAGCAGCCTTCTCGCCAGTACCTCGGCATCTGGTACCACAGCATCTCGCCGCGGACCGTCGTCTGGGTCGCCAACCGCGTCGCGCCGGCCACCTCGGCCTCGCCGTCGCTCACGCTCACCGTCACCGGCGACCTCCGCGTCCTCGACGGCACGGCGGCCAACGGCACCGCCGACGCGCCGCTGCTCTGGTCCTCCAACACCACCTCGCGCGCGGGCCCGCGGGGCGGCTACTCGGCGGTGCTCCAGGACACTGGCAGCCTCGAGGTGCGCAGCGAGGATGGGGTGCTCTGGGACAGCTTCTGGCACCCGACGGACACCATCCTGTCCGGGATGCGCATCACCTTGCAGGCGCCAGGGAGGGGCCCTAAGGAGCGGATGCTGTTCACGTCCTGGGCCAGCGAGACGGACCCTTCGCCGGGGCGATACGCGCTCGGCCTCGACCCGGGCAACTCCGGTCAGGCCTACATCTGGAAAGATGGCAACGTTACGTACTGGAGGTCGGGACAGTGGAATGGGGTGAATTTTATAGGCATTCCATGGAGGCCACTCTACAGGAGTGGGTTCACACCGGCAATTGATCCAGTGCTTGGAAATTATTACACATACACTGCAACAAACACTTCTTTGCAGAGGTTTGTTGTTTTGCCAAATGGCACAGACATCTGCTACATGGTTAGAAAATCTTCACAAGATTGGGAGCTTGTCTGGTACCAACCATCAAATGAGTGTGAATACTATGCTACATGTGGTCCAAATGCAAAATGCACTGCATCGCAAGATGGCAAGGCAAAATGCACCTGCCTAAAAGGTTTTCATCCGAAGTTGCAGGAGCAGTGGAATGCAGGAAATTGGAGTCAAGGTTGCATCAGGAGCCCACCTCTGGGTTGTGAGACCAATCAGTCTGGGGATGGATTTCTTCCAATGGGAAACATAAAGTGGCCTGATTTCTCATATTGGGTATCTACAGTGGGAGATGAGCCTGGATGCAGAACTGTCTGCCTTAACAACTGCTCATGCGGTGCTTATGTTTACACAGCTACAACAGGGTGCCTAGCCTGGGGTAACGAACTAATTGACATGCATGAGTTGCAAACAGGGGCATATACTCTAAACCTGAAGCTTCCTGCTTCTGAATTGCGAGGACATCACCCAATTTGGAAAATAGCCACGATAATATCAGCCATAGTGTTATTTGTTTTGGCTGCTTGCCTTCTTCTGTGGTGGAAGCATGGTAGAAATATTAAAGATGCAGTGCACGGAAGTTGGAGATCAAGGCATTCGTCTACCCAATCCCAGCAGAATAGTGCTATGCTGGACATCTCGCAGTCAATTCGTTTTGATGATGATGTGGAGGATGGAAAAAGTCATGAACTCAAAGTGTACTCGCTGGACCGTATAAGAACTGCTACAAGTAATTTTAGTGACTCTAACAAGCTTGGAGAAGGAGGATTTGGTCCTGTCTATATGGGAACTTTACCTGGGGGAGAAGAAGTAGCTGTGAAGAGGCTTTGTAGGAATTCAGGTCAAGGCCTTGAAGAATTCAAGAATGAGGTCATACTTATTGCAAAGTTGCAGCACCGCAATCTTGTAAGACTACTAGGGTGCTGCATACCGAGGGAAGAGAAGATCCTGGTGTATGAGTACATGCCTAACAAAAGTCTAGATGCATTCCTCTTTAATCCTGAAAAGCAACGGCTTCTAGACTGGAAGAAACGGTTTGATATAATCGAAGGCATTGCTAGAGGGCTGCTATATCTCCACCGGGATTCGAGGCTGCGAGTTGTTCACCGTGATCTCAAGGCCAGCAACATTCTCCTGGACGCGGACATGAAACCCAAGATATCAGATTTTGGAATGGCAAGGATGTTTGGAGGGGACCAAAACCAATTCAACACGAATCGGGTCGTCGGTACATTTGGCTACATGTCTCCTGAATACGCAATGGAAGGCATTTTTTCAGTCAAGTCTGACGTCTATGGCTTCGGAGTCCTGATCTTGGAGATCATCACAGGAAAGAGGGCTGTGAGCTTCCACTGTCACGAGGACTCCTTGAACATCGCTGGATATGCGTGGCGGCAATGGAACGAAGACAATGCTGCGGAGCTGATCGATCCAGTGATAAGAGCATCGTGCTCAGTTCGGCAGGTGCTGAGATGCATCCATATTGCGTTGCTGTGCGTGCAAGATCACGCAGATGAGCGACCTGACATCCCCACTGTCATCCTTATGCTGAGCAACGACAGCTCGAGCCTTCCTAATCCGAGGCCGCCTACCCTGATGCTTCGAGGCCGTGAGATCGAATCCAGCAAGTCAAGCGAGAAGGACCGGAGCCACTCCATTGGCACTGTGACAATGACACAGTTGCATGGAAGATGAAGTATAACACGAAAAATATACTGAATTTGTGATATATTTGGttttttttGTTCTCCCTTCCTGATGTTGATAATTTGCCATTTGTCGCGGATTAGTTTCCTCTTTTTCTCCTTTTCATGACGGCGACCGCGAAGTTGTATGAAAATCACATTAGCGTCATACATTAAGTGACAATTAATTTTGCAAAGGTGAAATATTTACC


Protein sequences

Name Description Sequence
Zm.359 translated coding region predicted by ESTScan from UniGene Zm.359

HGLLSSAPLPAPRRRLAMLCGGAEDGHAAAGGVAVRGGDAGVLAGGGVRGGLLPPDPKQPSRQYLGIWYHSISPRTVVWVANRVAPATSASPSLTLTVTGDLRVLDGTAANGTADAPLLWSSNTTSRAGPRGGYSAVLQDTGSLEVRSEDGVLWDSFWHPTDTILSGMRITLQAPGRGPKERMLFTSWASETDPSPGRYALGLDPGNSGQAYIWKDGNVTYWRSGQWNGVNFIGIPWRPLYRSGFTPAIDPVLGNYYTYTATNTSLQRFVVLPNGTDICYMVRKSSQDWELVWYQPSNECEYYATCGPNAKCTASQDGKAKCTCLKGFHPKLQEQWNAGNWSQGCIRSPPLGCETNQSGDGFLPMGNIKWPDFSYWVSTVGDEPGCRTVCLNNCSCGAYVYTATTGCLAWGNELIDMHELQTGAYTLNLKLPASELRGHHPIWKIATIISAIVLFVLAACLLLWWKHGRNIKDAVHGSWRSRHSSTQSQQNSAMLDISQSIRFDDDVEDGKSHELKVYSLDRIRTATSNFSDSNKLGEGGFGPVYMGTLPGGEEVAVKRLCRNSGQGLEEFKNEVILIAKLQHRNLVRLLGCCIPREEKILVYEYMPNKSLDAFLFNPEKQRLLDWKKRFDIIEGIARGLLYLHRDSRLRVVHRDLKASNILLDADMKPKISDFGMARMFGGDQNQFNTNRVVGTFGYMSPEYAMEGIFSVKSDVYGFGVLILEIITGKRAVSFHCHEDSLNIAGYAWRQWNEDNAAELIDPVIRASCSVRQVLRCIHIALLCVQDHADERPDIPTVILMLSNDSSSLPNPRPPTLMLRGREIESSKSSEKDRSHSIGTVTMTQLHGR

Domains

Domain Start-End Description Sequence

Seg: seg
21-52 seg

GGAEDGHAAAGGVAVRGGDAGVLAGGGVRGGL

ProfileScan: PS50927
IPR001480
26-159 BULB_LECTIN
Bulb-type lectin domain

GHAAAGGVAVRGGDAGVLAGGGVRGGLLPPDPKQPSRQYLGIWYHSISPRTVVWVANRVAPATSASPSLTLTVTGDLRVLDGTAANGTADAPLLWSSNTTSRAGPRGGYSAVLQDTGSLEVRSEDGVLWDSFWH

HMMSmart: SM00108
IPR001480
33-160 Bulb-type mannose-specific lectin
Bulb-type lectin domain

VAVRGGDAGVLAGGGVRGGLLPPDPKQPSRQYLGIWYHSISPRTVVWVANRVAPATSASPSLTLTVTGDLRVLDGTAANGTADAPLLWSSNTTSRAGPRGGYSAVLQDTGSLEVRSEDGVLWDSFWHP

HMMPanther: PTHR24420:SF755
55-817 OS07G0551300 PROTEIN

PDPKQPSRQYLGIWYHSISPRTVVWVANRVAPATSASPSLTLTVTGDLRVLDGTAANGTADAPLLWSSNTTSRAGPRGGYSAVLQDTGSLEVRSEDGVLWDSFWHPTDTILSGMRITLQAPGRGPKERMLFTSWASETDPSPGRYALGLDPGNSGQAYIWKDGNVTYWRSGQWNGVNFIGIPWRPLYRSGFTPAIDPVLGNYYTYTATNTSLQRFVVLPNGTDICYMVRKSSQDWELVWYQPSNECEYYATCGPNAKCTASQDGKAKCTCLKGFHPKLQEQWNAGNWSQGCIRSPPLGCETNQSGDGFLPMGNIKWPDFSYWVSTVGDEPGCRTVCLNNCSCGAYVYTATTGCLAWGNELIDMHELQTGAYTLNLKLPASELRGHHPIWKIATIISAIVLFVLAACLLLWWKHGRNIKDAVHGSWRSRHSSTQSQQNSAMLDISQSIRFDDDVEDGKSHELKVYSLDRIRTATSNFSDSNKLGEGGFGPVYMGTLPGGEEVAVKRLCRNSGQGLEEFKNEVILIAKLQHRNLVRLLGCCIPREEKILVYEYMPNKSLDAFLFNPEKQRLLDWKKRFDIIEGIARGLLYLHRDSRLRVVHRDLKASNILLDADMKPKISDFGMARMFGGDQNQFNTNRVVGTFGYMSPEYAMEGIFSVKSDVYGFGVLILEIITGKRAVSFHCHEDSLNIAGYAWRQWNEDNAAELIDPVIRASCSVRQVLRCIHIALLCVQDHADERPDIPTVILMLSNDSSSLPNPRPPTLM

HMMPanther: PTHR24420
55-817 FAMILY NOT NAMED,FAMILY NOT NAMED

PDPKQPSRQYLGIWYHSISPRTVVWVANRVAPATSASPSLTLTVTGDLRVLDGTAANGTADAPLLWSSNTTSRAGPRGGYSAVLQDTGSLEVRSEDGVLWDSFWHPTDTILSGMRITLQAPGRGPKERMLFTSWASETDPSPGRYALGLDPGNSGQAYIWKDGNVTYWRSGQWNGVNFIGIPWRPLYRSGFTPAIDPVLGNYYTYTATNTSLQRFVVLPNGTDICYMVRKSSQDWELVWYQPSNECEYYATCGPNAKCTASQDGKAKCTCLKGFHPKLQEQWNAGNWSQGCIRSPPLGCETNQSGDGFLPMGNIKWPDFSYWVSTVGDEPGCRTVCLNNCSCGAYVYTATTGCLAWGNELIDMHELQTGAYTLNLKLPASELRGHHPIWKIATIISAIVLFVLAACLLLWWKHGRNIKDAVHGSWRSRHSSTQSQQNSAMLDISQSIRFDDDVEDGKSHELKVYSLDRIRTATSNFSDSNKLGEGGFGPVYMGTLPGGEEVAVKRLCRNSGQGLEEFKNEVILIAKLQHRNLVRLLGCCIPREEKILVYEYMPNKSLDAFLFNPEKQRLLDWKKRFDIIEGIARGLLYLHRDSRLRVVHRDLKASNILLDADMKPKISDFGMARMFGGDQNQFNTNRVVGTFGYMSPEYAMEGIFSVKSDVYGFGVLILEIITGKRAVSFHCHEDSLNIAGYAWRQWNEDNAAELIDPVIRASCSVRQVLRCIHIALLCVQDHADERPDIPTVILMLSNDSSSLPNPRPPTLM

superfamily: SSF51110
IPR001480
62-228 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

RQYLGIWYHSISPRTVVWVANRVAPATSASPSLTLTVTGDLRVLDGTAANGTADAPLLWSSNTTSRAGPRGGYSAVLQDTGSLEVRSEDGVLWDSFWHPTDTILSGMRITLQAPGRGPKERMLFTSWASETDPSPGRYALGLDPGNSGQAYIWKDGNVTYWRSGQWN

HMMPfam: PF01453
IPR001480
74-195 B_lectin
Bulb-type lectin domain

PRTVVWVANRVAPATSASPSLTLTVTGDLRVLDGTAANGTADAPLLWSSNTTSRAGPRGGYSAVLQDTGSLEVRSEDGVLWDSFWHPTDTILSGMRITLQAPGRGPKERMLFTSWASETDPS

Gene3D: G3DSA:2.90.10.10
IPR001480
196-233 no description
Bulb-type lectin domain

PGRYALGLDPGNSGQAYIWKDGNVTYWRSGQWNGVNFI

HMMPfam: PF00954
IPR000858
222-331 S_locus_glycop
S-locus glycoprotein

WRSGQWNGVNFIGIPWRPLYRSGFTPAIDPVLGNYYTYTATNTSLQRFVVLPNGTDICYMVRKSSQDWELVWYQPSNECEYYATCGPNAKCTASQDGKAKCTCLKGFHPK

ProfileScan: PS50026
IPR000742
296-334 EGF_3
Epidermal growth factor-like, type 3

PSNECEYYATCGPNAKCTASQDGKAKCTCLKGFHPKLQE

HMMPfam: PF08276
IPR013227
353-417 PAN_2
PAN-2 domain

CETNQSGDGFLPMGNIKWPDFSYWVSTVGDEPGCRTVCLNNCSCGAYVYTATTGCLAWGNELIDM

ProfileScan: PS50948
IPR003609
353-433 PAN
Apple-like

CETNQSGDGFLPMGNIKWPDFSYWVSTVGDEPGCRTVCLNNCSCGAYVYTATTGCLAWGNELIDMHELQTGAYTLNLKLPA

HMMSmart: SM00473
IPR003609
357-431 divergent subfamily of APPLE domains
Apple-like

QSGDGFLPMGNIKWPDFSYWVSTVGDEPGCRTVCLNNCSCGAYVYTATTGCLAWGNELIDMHELQTGAYTLNLKL

superfamily: SSF56112
IPR011009
502-824 Protein kinase-like (PK-like)
Protein kinase-like domain

RFDDDVEDGKSHELKVYSLDRIRTATSNFSDSNKLGEGGFGPVYMGTLPGGEEVAVKRLCRNSGQGLEEFKNEVILIAKLQHRNLVRLLGCCIPREEKILVYEYMPNKSLDAFLFNPEKQRLLDWKKRFDIIEGIARGLLYLHRDSRLRVVHRDLKASNILLDADMKPKISDFGMARMFGGDQNQFNTNRVVGTFGYMSPEYAMEGIFSVKSDVYGFGVLILEIITGKRAVSFHCHEDSLNIAGYAWRQWNEDNAAELIDPVIRASCSVRQVLRCIHIALLCVQDHADERPDIPTVILMLSNDSSSLPNPRPPTLMLRGREIE

Gene3D: G3DSA:3.30.200.20
512-592 no description

SHELKVYSLDRIRTATSNFSDSNKLGEGGFGPVYMGTLPGGEEVAVKRLCRNSGQGLEEFKNEVILIAKLQHRNLVRLLGC

ProfileScan: PS50011
IPR000719
530-781 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSDSNKLGEGGFGPVYMGTLPGGEEVAVKRLCRNSGQGLEEFKNEVILIAKLQHRNLVRLLGCCIPREEKILVYEYMPNKSLDAFLFNPEKQRLLDWKKRFDIIEGIARGLLYLHRDSRLRVVHRDLKASNILLDADMKPKISDFGMARMFGGDQNQFNTNRVVGTFGYMSPEYAMEGIFSVKSDVYGFGVLILEIITGKRAVSFHCHEDSLNIAGYAWRQWNEDNAAELIDPVIRASCSVRQVLRCIHIAL

HMMSmart: SM00219
IPR020635
530-801 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSDSNKLGEGGFGPVYMGTLPGGEEVAVKRLCRNSGQGLEEFKNEVILIAKLQHRNLVRLLGCCIPREEKILVYEYMPNKSLDAFLFNPEKQRLLDWKKRFDIIEGIARGLLYLHRDSRLRVVHRDLKASNILLDADMKPKISDFGMARMFGGDQNQFNTNRVVGTFGYMSPEYAMEGIFSVKSDVYGFGVLILEIITGKRAVSFHCHEDSLNIAGYAWRQWNEDNAAELIDPVIRASCSVRQVLRCIHIALLCVQDHADERPDIPTVILML

HMMSmart: SM00220
IPR002290
530-808 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSDSNKLGEGGFGPVYMGTLPGGEEVAVKRLCRNSGQGLEEFKNEVILIAKLQHRNLVRLLGCCIPREEKILVYEYMPNKSLDAFLFNPEKQRLLDWKKRFDIIEGIARGLLYLHRDSRLRVVHRDLKASNILLDADMKPKISDFGMARMFGGDQNQFNTNRVVGTFGYMSPEYAMEGIFSVKSDVYGFGVLILEIITGKRAVSFHCHEDSLNIAGYAWRQWNEDNAAELIDPVIRASCSVRQVLRCIHIALLCVQDHADERPDIPTVILMLSNDSSSL

HMMPfam: PF07714
IPR001245
533-798 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SNKLGEGGFGPVYMGTLPGGEEVAVKRLCRNSGQGLEEFKNEVILIAKLQHRNLVRLLGCCIPREEKILVYEYMPNKSLDAFLFNPEKQRLLDWKKRFDIIEGIARGLLYLHRDSRLRVVHRDLKASNILLDADMKPKISDFGMARMFGGDQNQFNTNRVVGTFGYMSPEYAMEGIFSVKSDVYGFGVLILEIITGKRAVSFHCHEDSLNIAGYAWRQWNEDNAAELIDPVIRASCSVRQVLRCIHIALLCVQDHADERPDIPTVI

Gene3D: G3DSA:1.10.510.10
593-735 no description

CIPREEKILVYEYMPNKSLDAFLFNPEKQRLLDWKKRFDIIEGIARGLLYLHRDSRLRVVHRDLKASNILLDADMKPKISDFGMARMFGGDQNQFNTNRVVGTFGYMSPEYAMEGIFSVKSDVYGFGVLILEIITGKRAVSFH

PatternScan: PS00108
IPR008271
651-663 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHRDLKASNILL

Seg: seg
821-837 seg

REIESSKSSEKDRSHSI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox