PRGDB00063900 (Zm.721)

From PRG Wiki
Revision as of 13:26, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Zm.721
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195625991 (EU962708)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays clone 244884 hypothetical protein mRNA, complete cds

DNA Sequence

ATTTTTTCGCCAGCTCATCGCCACCGCCCTCCTCCGCTCCCGCGTCTTCTTCCCCTCGTCGTCGTCGGGTTGGTGGGTCCACCTCTCGCCGTGCCCCGCCGTCGACCCGCCTCAGATAAGTCAAAGGAAAGGTCGGTATGCGCCGGTGGTTTTGCTGCACGAGGTTTAATGCTTCATACCGTGAACATGAAAATGAACGTCCCATCACTCCAGAGGAGAAAGAAGGAAATGGTTTTTCTGTTAAAAGTGATCCCATCAAGGCACCACCTTCCATTGAAGTCCCTGAATTATCATTTGAAGAATTGAAAGAAAAGACCGACAATTTTGGTTCAATGGCTTTGATTGGTGAGGGGTCATATGGAAGAGTATATTATGCTATTCTGGACAGCGGAAAACATGTTGCTGTTAAAAAGCTTGACGCTTCAACAGACCCTGAACTTGATAATGAGTTTTTGACACAGGTATCCATTGCCTCAAAACTAAAACATGATAATTTTGTGGAGATGCTTGGATATTGTGTGGAAGGAAATCAGCGTCTAGTGGTCTATGAATTTGCGACAATGGGTTCTCTGCATGATATCTTGCATGGAAGAAAGGGTGTTCCAGGTGCACAGCCTGGCCCAGCACTTGATTGGATGCAGCGGGTTAAGATTGCTATTGATGCTGCTAAAGGGCTAGAGTATCTTCATGAAAAGGTGCAGCCTTCAATAGTCCACCGGGACATACGGTCTAGCAATATTCTTCTGTTTGAGGACTACAGAGCGAAAATTGCAGATTTCAATCTTTCGAATCAGTCTCCAGATATGGCTGCTCGTTTGCATTCTACTCGTGTCCTTGGAACCTTCGGCTACCATGCTCCCGAGTATGCCATGACTGGCCAGCTAACTCAGAAGAGTGATGTATATAGCTTTGGGGTTGTTCTTTTAGAGCTTCTAACAGGAAGGAAACCAGTAGATCATACAATGCCTAGAGGTCAGCAGAGTCTGGTTACATGGGCAACACCTAGATTGACTGAGGACACAGTTAAACAATGTGTTGATCCAAGATTGAAGGGAGAATATCCTCCAAAGGGAGTTGCCAAGCTTGCGGCTGTGGCGGCACTGTGTGTGCAATATGAATCTGAATTTAGACCCAGCATGAGCATCGTAGTTAAGGCACTCTCTCCCCTTYTTCAACATAAACCGCAACCACCGGCAGCCACTACTGACGCTACAGCACCGTCAGATGCCTGACTTTCTGAAGGAGCTATGAATCATGAATGTTAAGAGAACCATTTTCTCTTCGGTGCGTGCGCTGTTCTAGATCACTATCGTGTGCCTATGAAGTGATCAGTGTCACACAAGCAACGGCATTGTGGGCTAAAGCATATCTCCACCTTTACTTAGCTTGGTACAGGCAGGAGACTTCCCATTGTCATTACCGTGTTCTATGCTGAGTCATGTGCTGCTTTCGTTGGCCGGGTGAGGTGTGCTTGTTGGCCAGCGGTCGTGACCACCTAATTACCGTGTTATGGTCATCACTGTAACATGCGAAGGTTCTAAtttttttttcatggtttgtttttcctcgtttttttgatggatcgtttttccttattttgtttgcctgtcgtctgattttGAACTGGCGCCTCCACTGTACAACCCACTCTGAATCGCGAGACTACTCGTGTGCATGTTTATGCGTGAGAATTGTGAAGaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.721 translated coding region predicted by ESTScan from UniGene Zm.721

XFFASSSPPPSSAPASSSPRRRRVGGSTSRRAPPSTRLRXVKGKVGMRRWFCCTRFNASYREHENERPITPEEKEGNGFSVKSDPIKAPPSIEVPELSFEELKEKTDNFGSMALIGEGSYGRVYYAILDSGKHVAVKKLDASTDPELDNEFLTQVSIASKLKHDNFVEMLGYCVEGNQRLVVYEFATMGSLHDILHGRKGVPGAQPGPALDWMQRVKIAIDAAKGLEYLHEKVQPSIVHRDIRSSNILLFEDYRAKIADFNLSNQSPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLTEDTVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYESEFRPSMSIVVKALSPLXQHKPQPPAATTDATAPSDA

Domains

Domain Start-End Description Sequence

Seg: seg
4-32 seg

ASSSPPPSSAPASSSPRRRRVGGSTSRRA

superfamily: SSF56112
IPR011009
79-395 Protein kinase-like (PK-like)
Protein kinase-like domain

FSVKSDPIKAPPSIEVPELSFEELKEKTDNFGSMALIGEGSYGRVYYAILDSGKHVAVKKLDASTDPELDNEFLTQVSIASKLKHDNFVEMLGYCVEGNQRLVVYEFATMGSLHDILHGRKGVPGAQPGPALDWMQRVKIAIDAAKGLEYLHEKVQPSIVHRDIRSSNILLFEDYRAKIADFNLSNQSPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLTEDTVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYESEFRPSMSIVVKALSPLXQHKP

HMMPanther: PTHR24420:SF416
82-399 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

KSDPIKAPPSIEVPELSFEELKEKTDNFGSMALIGEGSYGRVYYAILDSGKHVAVKKLDASTDPELDNEFLTQVSIASKLKHDNFVEMLGYCVEGNQRLVVYEFATMGSLHDILHGRKGVPGAQPGPALDWMQRVKIAIDAAKGLEYLHEKVQPSIVHRDIRSSNILLFEDYRAKIADFNLSNQSPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLTEDTVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYESEFRPSMSIVVKALSPLXQHKPQPPA

HMMPanther: PTHR24420
82-399 FAMILY NOT NAMED,FAMILY NOT NAMED

KSDPIKAPPSIEVPELSFEELKEKTDNFGSMALIGEGSYGRVYYAILDSGKHVAVKKLDASTDPELDNEFLTQVSIASKLKHDNFVEMLGYCVEGNQRLVVYEFATMGSLHDILHGRKGVPGAQPGPALDWMQRVKIAIDAAKGLEYLHEKVQPSIVHRDIRSSNILLFEDYRAKIADFNLSNQSPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLTEDTVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYESEFRPSMSIVVKALSPLXQHKPQPPA

Gene3D: G3DSA:3.30.200.20
93-185 no description

EVPELSFEELKEKTDNFGSMALIGEGSYGRVYYAILDSGKHVAVKKLDASTDPELDNEFLTQVSIASKLKHDNFVEMLGYCVEGNQRLVVYEF

ProfileScan: PS50011
IPR000719
109-391 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FGSMALIGEGSYGRVYYAILDSGKHVAVKKLDASTDPELDNEFLTQVSIASKLKHDNFVEMLGYCVEGNQRLVVYEFATMGSLHDILHGRKGVPGAQPGPALDWMQRVKIAIDAAKGLEYLHEKVQPSIVHRDIRSSNILLFEDYRAKIADFNLSNQSPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLTEDTVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYESEFRPSMSIVVKALSPLX

HMMSmart: SM00220
IPR002290
109-391 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FGSMALIGEGSYGRVYYAILDSGKHVAVKKLDASTDPELDNEFLTQVSIASKLKHDNFVEMLGYCVEGNQRLVVYEFATMGSLHDILHGRKGVPGAQPGPALDWMQRVKIAIDAAKGLEYLHEKVQPSIVHRDIRSSNILLFEDYRAKIADFNLSNQSPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLTEDTVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYESEFRPSMSIVVKALSPLX

HMMSmart: SM00219
IPR020635
109-387 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FGSMALIGEGSYGRVYYAILDSGKHVAVKKLDASTDPELDNEFLTQVSIASKLKHDNFVEMLGYCVEGNQRLVVYEFATMGSLHDILHGRKGVPGAQPGPALDWMQRVKIAIDAAKGLEYLHEKVQPSIVHRDIRSSNILLFEDYRAKIADFNLSNQSPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLTEDTVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYESEFRPSMSIVVKAL

HMMPfam: PF07714
IPR001245
114-387 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

LIGEGSYGRVYYAILDSGKHVAVKKLDASTDPELDNEFLTQVSIASKLKHDNFVEMLGYCVEGNQRLVVYEFATMGSLHDILHGRKGVPGAQPGPALDWMQRVKIAIDAAKGLEYLHEKVQPSIVHRDIRSSNILLFEDYRAKIADFNLSNQSPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLTEDTVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYESEFRPSMSIVVKAL

PatternScan: PS00107
IPR017441
115-138 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGSYGRVYYAILDSGKHVAVKK

Gene3D: G3DSA:1.10.510.10
189-386 no description

GSLHDILHGRKGVPGAQPGPALDWMQRVKIAIDAAKGLEYLHEKVQPSIVHRDIRSSNILLFEDYRAKIADFNLSNQSPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLTEDTVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYESEFRPSMSIVVKA

PatternScan: PS00109
IPR008266
237-249 PROTEIN_KINASE_TYR
Tyrosine-protein kinase, active site

IVHRDIRSSNILL

Seg: seg
355-368 seg

PPKGVAKLAAVAAL

Seg: seg
397-410 seg

PPAATTDATAPSDA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox