PRGDB00064004 (Zm.17757)

From PRG Wiki
Revision as of 13:24, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Zm.17757
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 223947126 (BT062950)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFc0011N11 mRNA, complete cds

DNA Sequence

CAgattatttgatcgatatttttttctcattttctcataaatatattttcttatattACCTCCTAGTAAGAAGTAATATGTGCTAGTGCTATATATGAAGCGCACCACAGATTGTGCGGTGGCGGCCAGAGCAAAGGCGATCACGGCAATGTCGTCGAGCccatcgctgatctgctgctccatgtcgctcggcctgctctctctgctgctgcttctcttctcgGCCTGTTACACCGCCCCCACCTACGCCACGGACTGCGACCCCGCGGACCGCGCCGCGCTGCTGCGGGTGAAGGCGCAGCTCGGCGACCCGGCGCAGCTCTCCTCATGGCTGCCGTCCACTAACTGCTGCGCGTGGGACCCGGCAGTGTTCTGCAACGCGGCGGGCCGTGTGACGGGGCTGGCCCTCTACGCCCTGCCCGACGTCTCGGCGCGAGTCCCGCCGGCGCTCGGCGACCTCGCGGCACTCGAGATCCTCCAGGTGGACTCTGTGCCGGGCCTGGCGGGCCCCGTCCCGGCCTCCTTCGCCAACCTCACGCGCCTCCTCGACCTCGACATCAACGGCACCTCCATCTCCGGGCCCATCCCGGGCTGCCTCCTCGCCGCTGCCGTCAACCTGAGGACGCTCGTCATCGCCAACAGCAAGCTGGCCGGGCCCATCCCGTCGTCCCTGGCCGCACTCCCCGGCCTCCGGTACCTGGACCTCAGCGGCAACATGCTGAGCGGCGCCATCCCGCCGGAGCTGCTGCACGGGAGCTCCAGGTTCCTGATCCTGTCCAACAACCGGCTCACGGGGGAGATACCCGGAGAGTACGGTGACGGCGACGTCGACACCATCGACCTCTCGCACAACCAGCTCACCGGTGACCCCTCGTCGTTCCTGTTCGGCATCACGAAGCCGGCGGTCAAGATCGACCTGTCGTGGAACCAGCTCGAGTTCGACCTGACGGAGGTCAGGTTCCCGCACCACCTCAGGTTCCTGGACCTGAGCCACAACAGGGTCAGGGGCAGAGTGGCCAAGTCGCTGATGGACGTGAGGCTGGATCACTTCGACGTCAGCTATAACGAGCTCTGCGGCGAGCTCCCGGCGGGAAGGTTCATGTCCATGCACGAGGCAGAGTGCTACGCGCACAACAAGTGCCTGTGCGGCACGCCGCTCCCTCCGTGCAACTGAATCACTGCACTGGTTCAGGCTGTGCAATGATCACTGGTTTAATCTTGTGCGAACAAGTTGTTAGTTGTACCAGAACAGCGAATCAGTTGGTCGGGTATCCACGCTCAATGTTGGCTTTGGTATCGGATAATCTCTCTTGATCTGCACTTGTTTCAATTAGATTAGCTATAACATACGTGCAGGGACGTAAACGGTCGAGAAAAC


Protein sequences

Name Description Sequence
Zm.17757 translated coding region predicted by ESTScan from UniGene Zm.17757

MSSSPSLICCSMSLGLLSLLLLLFSACYTAPTYATDCDPADRAALLRVKAQLGDPAQLSSWLPSTNCCAWDPAVFCNAAGRVTGLALYALPDVSARVPPALGDLAALEILQVDSVPGLAGPVPASFANLTRLLDLDINGTSISGAHPGLPPRRCRQPEDARHRQQQAGRAHPVVPGRTPRPPVPGPQRQHAERRHPAGAAARELQVPDPVQQPAHGGDTRRVRXRRRRHHRPLAQPAHRXPLVVPVRHHEAGGQDRPVVEPARVRPDGGQVPAPPQVPGPEPQQGQGQSGQVADGREAGSLRRQLXRALRRAPGGKVHVHARGRVLRAQQVPVRHAAPSVQLNHCTGSGCAMITGLILCEQVVSCTRTANQLVGYPRSMLALVSDNLSXSALVSIRLAITYVQGRKRSRKX

Domains

Domain Start-End Description Sequence

Seg: seg
1-25 seg

MSSSPSLICCSMSLGLLSLLLLLFS

HMMPanther: PTHR24420
5-147 FAMILY NOT NAMED,FAMILY NOT NAMED

PSLICCSMSLGLLSLLLLLFSACYTAPTYATDCDPADRAALLRVKAQLGDPAQLSSWLPSTNCCAWDPAVFCNAAGRVTGLALYALPDVSARVPPALGDLAALEILQVDSVPGLAGPVPASFANLTRLLDLDINGTSISGAHP

superfamily: SSF52058
35-148 L domain-like,LRR

TDCDPADRAALLRVKAQLGDPAQLSSWLPSTNCCAWDPAVFCNAAGRVTGLALYALPDVSARVPPALGDLAALEILQVDSVPGLAGPVPASFANLTRLLDLDINGTSISGAHPG

Gene3D: G3DSA:3.80.10.10
37-148 no description

CDPADRAALLRVKAQLGDPAQLSSWLPSTNCCAWDPAVFCNAAGRVTGLALYALPDVSARVPPALGDLAALEILQVDSVPGLAGPVPASFANLTRLLDLDINGTSISGAHPG

HMMPfam: PF08263
IPR013210
39-71 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

PADRAALLRVKAQLGDPAQLSSWLPSTNCCAWD

Seg: seg
172-189 seg

PVVPGRTPRPPVPGPQRQ

Seg: seg
220-231 seg

RRVRXRRRRHHR

Seg: seg
266-295 seg

PDGGQVPAPPQVPGPEPQQGQGQSGQVADG

Seg: seg
301-312 seg

LRRQLXRALRRA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox