PRGDB00064019 (Zm.19677)

From PRG Wiki
Revision as of 13:23, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Zm.19677
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 194695527 (BT036843)
Gene Class Unknown
Domain Type
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0143E16 mRNA, complete cds

DNA Sequence

CTCGGAGAGTAGTAAGCTGTCACGGTCACCGGCCGGCCTCGCTCCGATCctctctctctcgttctctcACTGAGAAGAAGAGAGAACCAAGTGGTCAGAACTCAGAAGCTTGGCATAGAAATCCCTGCTTGGCCACGATCGCCTTCTTCTAATCTACAGATTATATTCCTCATAAACGCTCGTACGTACGTACCAAATTATCAAGCAAAGGTCTCCAAATGGCTGGCCTGTCTCTACAGCATCCCATGGCCTTCGCCTTCGGCCTCCTCGGCAACATCATCTCCTTCATGACGTACTTGGCCCCGCTGCCGACGTTCTGCCGGATCTACAGGAACAAGTCGACGGAGGGGTTCCAGTCGGTGCCGTACGTGGTGGCGCTCTTCAGCGCCATGCTGTGGATCTACTACGCGCTGCTCAAGTCCAACGAGTTCCTGCTCATCACCATCAACTCCGCCGGCTGCGTCATCGAGACCCTCTACATCGCCACCTACCTCCTCTACGCGCCCAACAAGGCAAAGCTGTTCACGGCCAAGATCCTCCTCCTCCTCAACGTGGGCGTGTTCGGCCTCATCCTCCTCCTCACGCTGCTGCTCTCCGCGGGGCCGCACCGCGTCGTCGTCCTCGGCTGGGTCTGCGTCGCCTTCTCCGTCAGCGTCTTCGTCGCGCCGCTCAGCATCATCCGCCAGGTGGTGCGCACGCGGAGCGTGGAGTTCATGCCCTTCTCCCTCTCCTTCTCGCTCACCGCCAGCGCCGTCGTCTGGTTCCTCTACGGCCTGCTCATCAAGGACAAATACGTCGCCCTGCCAAACGTGCTCGGCTTCACCTTCGGCGTCGTCCAGATGGGCATGTACGCGCTCTACCGTAACGCGACGCCCAGGGTGCCTGCTGCCAAGGAggcggcggcggcggcggACGACGGCAACACCTTCAACTTCAAGGCGCCCGGCGAGCATGTGGTGACCATCGCCAAGCTGACCGCAGCGGCGCCTGCGACGGCGGCGGAGCTTATCATCAAGGCCCGCGACGACGCGCAGCACCCCCCGGAGGAAGAAGCAGCAGCAGCCAAGGCGGCGCCGGCGAAGTCTAAATTATTAATCCCCCTCCCAGAACATGCGTACGCATGTATGTGTATCATCCGGTCCGGGTCACATCATAAACTAGGCCGTGCGTGCCTGCTCGGTACTAGCACACGCCCGCCCGCCTGCCTGCCCGCCCGCATGATCCAATCGAGCTGCTATATACGAAAGGGATGAAGACGATGAGATCTACTCTGAGAGAACCAGAAGGGGGCTAGCTAGGGCCATGTCTCTCGCCTCAGGTCGTGGGTCTGCTGCTGCTGTTTCATTTCGTTCTCGCGCATGGCTGCGCGCGTGTATTCATTTTAGTTAGCTACTTGTTGTCCCGTCACCACCTTCGTTCCATGTAATAACAACAAAATATATATAAACATGGTCATCGTAAAGCAAAGGTTCCTTTTTTATCAAATC


Protein sequences

Name Description Sequence
Zm.19677 translated coding region predicted by ESTScan from UniGene Zm.19677

MAGLSLQHPMAFAFGLLGNIISFMTYLAPLPTFCRIYRNKSTEGFQSVPYVVALFSAMLWIYYALLKSNEFLLITINSAGCVIETLYIATYLLYAPNKAKLFTAKILLLLNVGVFGLILLLTLLLSAGPHRVVVLGWVCVAFSVSVFVAPLSIIRQVVRTRSVEFMPFSLSFSLTASAVVWFLYGLLIKDKYVALPNVLGFTFGVVQMGMYALYRNATPRVPAAKEAAAAADDGNTFNFKAPGEHVVTIAKLTAAAPATAAELIIKARDDAQHPPEEEAAAAKAAPAKSKLLIPLPEHAYACMCIIRSGSHHKLGRACLLGTSTRPPPACPPAXSNRAAIYERDEDDEIYSERTRRGLARAMSLASGRGSAAAVSFRSRAW


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10791
IPR004316
1-222 RAG1-ACTIVATING PROTEIN 1
RAG1-activating protein-1-related

MAGLSLQHPMAFAFGLLGNIISFMTYLAPLPTFCRIYRNKSTEGFQSVPYVVALFSAMLWIYYALLKSNEFLLITINSAGCVIETLYIATYLLYAPNKAKLFTAKILLLLNVGVFGLILLLTLLLSAGPHRVVVLGWVCVAFSVSVFVAPLSIIRQVVRTRSVEFMPFSLSFSLTASAVVWFLYGLLIKDKYVALPNVLGFTFGVVQMGMYALYRNATPRVP

HMMPfam: PF03083
IPR004316
13-98 MtN3_slv
RAG1-activating protein-1-related

AFGLLGNIISFMTYLAPLPTFCRIYRNKSTEGFQSVPYVVALFSAMLWIYYALLKSNEFLLITINSAGCVIETLYIATYLLYAPNK

Seg: seg
117-125 seg

LILLLTLLL

HMMPfam: PF03083
IPR004316
134-217 MtN3_slv
RAG1-activating protein-1-related

VLGWVCVAFSVSVFVAPLSIIRQVVRTRSVEFMPFSLSFSLTASAVVWFLYGLLIKDKYVALPNVLGFTFGVVQMGMYALYRNA

Seg: seg
140-149 seg

VAFSVSVFVA

Seg: seg
223-231 seg

AAKEAAAAA

Seg: seg
248-267 seg

TIAKLTAAAPATAAELIIKA

Seg: seg
274-288 seg

PPEEEAAAAKAAPAK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox