PRGDB00064252 (Zm.66868)

From PRG Wiki
Revision as of 13:17, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Zm.66868
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 223945330 (BT062052)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0209I09 mRNA, complete cds

DNA Sequence

CCCACCACCATGGCCTCGACCTCGTCCGTCTGGTCGGTGTGGATCGCCCTGTCGCTGACGCTAACGCTTGCCTCGGCATCACCAGCTGACGGGCAAGGGGGCGGAGGAGCACACTGCCCGCCCGTGCTATGCGGCGGCGTGGAGATCGCCTTCCCGTTCGGGATCGTCCAGGAGCAGGCGACGGCCACCAACTGCGGCGGGATCGGGTTCCAGGTCCGCTGCGTCAACGGCACGCCGTACCTCGGATACAGCCGGTACGACCACTGGCTCCAGATCCTCAGCGTCTCCTACACCAACGCCTCCTTGCTCGTCGCCGACACCCACAAGCTCGAGAAGCTGGGAGCCTCGGACGGCGGCGGCGACTCCGCCGTCTGCCGCATCCCCGGGAACAACAGCTCCACCAAGGTCGCCCTCCCGTTCTCCATCAGCCCTCTCAACCAGGACCTCATCCTGTACAACTGCACCAAGGCGCCGGCGCCGGCGCCGGACGAGGAGGGGCTTGTGGAGATGACGAGATGCGGCAACCGCACTTTCGCCCGCATCGGAGGGCGTTACGGCGAGCCGGACGACGACGGCGGATACTCCTTGGACGGCTGCGGTGCCACTGTCGTGCCCGTGCTTGTAAAGGACGATGGCAAGGCGAACGCGAGCGACTACGAGCAACTCATAAGTGGCGGCTTCCTCTTGACATGGCAGTGGCAGACAAGAGGAAACAGCAACAAAAATAGGATACTCGGAATTGTTTGTGGAGTAGCAGGAGGCGGTCTATTGGTAGTGTCAGTGTGCTTCTTTTTTGTCTGGCGCAAGCACAAAAGAAGGAAACAAGCAAGAGCACCGAATGGCTGCATGCGTAGCGAATCTTCGATGCAATCGTATAGCAAAGACCTTGAGTTGGGTGGCTCTCCACACATTTTCACTTACGAGGAGCTTGAAGAAGCTACTGATGGATTTAATGACTCGAGGGAGCTTGGTGATGGTGGTTTCGGAACTGTTTACAAAGGGAAACTCCGGGACGGGAGAGTCGTTGCGGTGAAACGCCTGTACAAGAACAACTACAAACGGGTGGAGCAGTTCATAAACGAGGTAGACATTTTGTCCCGCCTCCTCCACCAGAACCTGGTCATCCTCTATGGCTGCACATCCCGTAGCAGCCGCGACCTCATGCTCGTGTACGAGTTCATCCCCAACGGAACAGTCGCGGACCATGTCCACGGATCCCGTGCGTCGGAGCGCGGCCTCACGTGGCCTCGAAGGATGAGCATCGCCATAGAAACAGCTGAGGCGCTGGCGTACCTCCACGCGGTCGAGATCATACACCGTGACGTGAAGACCAACAACATACTGCTGGACAACAGCTTCCACGTGAAGGTCGCCGACTTTGGGCTGTCGCGCCTGTACCCTCCTGAAGTCACCCACGTGTCGACCGTCCCACAGGGCACGCCGGGCTACGTCGACCCGGTGTACCACCAGTGCTACAAGCTGACCGAGAAGAGCGACGTGTACAGCTTCGGCGTCGTGCTGGTCGAGCTCGTGTCCTCTAAGCCAGCCGTCGACATGGGCAGGAGCCACAGCGAGATCAACCTGGCCAACATGGCTCTCAACAGAATCCAGAACCACGAGGTGGGCCAGCTGGTCGACCCTGAGCTCGGGTACGAGACTGACGGTGAGACGAAGAGATCCATAGATCTCGTGGCTGAGCTGGCGTTCCGGTGCTTGCAGCTAGAAAGGGATTCACGGCCGTCGATGAAGGAAGTGGTGGAGGCCCTGAACCGTATCAGGAACGGGGATTCACTGGAGAATAACAAGACGGACAGGAGCTCCTCGTCTCCTAAGGAAGACGCACGCCTGCTGACGAGTAGCATACAGTACTCTCCTGACTCGGTAATCCACAGATTCCATAGCCAATCAACCACGCACTCGGCAGCGTCAAATGCTAGCGGGTGAGATAGATACCCGGCCATGTGTGTATATACCGATCCTGAAGAAACGAAGCCCTTACCAGACGATGTTTGTGTACAGTGTAGAGATCTGCCAATGAGCTGATTCATCTGGGTGAGTTGTTTCTTTTCTCTTTTGTTGACTGGTTCGTAGTACAATGTATACAGTCACGCTGTAGCCACAGCAGGAGCTTGGCATAAATTAAGACATTATTAGGCAAAGCAGTAGAATCAGTGTCAGGCCAAAATTGTACTGTAGGAACTAtttttttcgttttGACGAATGAAGGGGGGCTCTGCCGATGACAGAAGTAGAGCTACACGAAATAGGAAGGAATAAAAGCTGTATACTTCGTACTCTAATTGGCTGAGAGGCCACCATTTGGTTTCGCGCGTACGTTTAATAGCCTTGCTGTAAGGAAGAGCAGACTATATATGCCTGTACATATGCCAGAACCGAGC


Protein sequences

Name Description Sequence
Zm.66868 translated coding region predicted by ESTScan from UniGene Zm.66868

PTTMASTSSVWSVWIALSLTLTLASASPADGQGGGGAHCPPVLCGGVEIAFPFGIVQEQATATNCGGIGFQVRCVNGTPYLGYSRYDHWLQILSVSYTNASLLVADTHKLEKLGASDGGGDSAVCRIPGNNSSTKVALPFSISPLNQDLILYNCTKAPAPAPDEEGLVEMTRCGNRTFARIGGRYGEPDDDGGYSLDGCGATVVPVLVKDDGKANASDYEQLISGGFLLTWQWQTRGNSNKNRILGIVCGVAGGGLLVVSVCFFFVWRKHKRRKQARAPNGCMRSESSMQSYSKDLELGGSPHIFTYEELEEATDGFNDSRELGDGGFGTVYKGKLRDGRVVAVKRLYKNNYKRVEQFINEVDILSRLLHQNLVILYGCTSRSSRDLMLVYEFIPNGTVADHVHGSRASERGLTWPRRMSIAIETAEALAYLHAVEIIHRDVKTNNILLDNSFHVKVADFGLSRLYPPEVTHVSTVPQGTPGYVDPVYHQCYKLTEKSDVYSFGVVLVELVSSKPAVDMGRSHSEINLANMALNRIQNHEVGQLVDPELGYETDGETKRSIDLVAELAFRCLQLERDSRPSMKEVVEALNRIRNGDSLENNKTDRSSSSPKEDARLLTSSIQYSPDSVIHRFHSQSTTHSAASNASG

Domains

Domain Start-End Description Sequence

Seg: seg
16-27 seg

ALSLTLTLASAS

HMMPfam: PF13947
IPR025287
37-155 GUB_WAK_bind
Wall-associated receptor kinase galacturonan-bindi

AHCPPVLCGGVEIAFPFGIVQEQATATNCGGIGFQVRCVNGTPYLGYSRYDHWLQILSVSYTNASLLVADTHKLEKLGASDGGGDSAVCRIPGNNSSTKVALPFSISPLNQDLILYNCT

HMMPanther: PTHR24420:SF426
238-627 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

NSNKNRILGIVCGVAGGGLLVVSVCFFFVWRKHKRRKQARAPNGCMRSESSMQSYSKDLELGGSPHIFTYEELEEATDGFNDSRELGDGGFGTVYKGKLRDGRVVAVKRLYKNNYKRVEQFINEVDILSRLLHQNLVILYGCTSRSSRDLMLVYEFIPNGTVADHVHGSRASERGLTWPRRMSIAIETAEALAYLHAVEIIHRDVKTNNILLDNSFHVKVADFGLSRLYPPEVTHVSTVPQGTPGYVDPVYHQCYKLTEKSDVYSFGVVLVELVSSKPAVDMGRSHSEINLANMALNRIQNHEVGQLVDPELGYETDGETKRSIDLVAELAFRCLQLERDSRPSMKEVVEALNRIRNGDSLENNKTDRSSSSPKEDARLLTSSIQYSPDS

HMMPanther: PTHR24420
238-627 FAMILY NOT NAMED,FAMILY NOT NAMED

NSNKNRILGIVCGVAGGGLLVVSVCFFFVWRKHKRRKQARAPNGCMRSESSMQSYSKDLELGGSPHIFTYEELEEATDGFNDSRELGDGGFGTVYKGKLRDGRVVAVKRLYKNNYKRVEQFINEVDILSRLLHQNLVILYGCTSRSSRDLMLVYEFIPNGTVADHVHGSRASERGLTWPRRMSIAIETAEALAYLHAVEIIHRDVKTNNILLDNSFHVKVADFGLSRLYPPEVTHVSTVPQGTPGYVDPVYHQCYKLTEKSDVYSFGVVLVELVSSKPAVDMGRSHSEINLANMALNRIQNHEVGQLVDPELGYETDGETKRSIDLVAELAFRCLQLERDSRPSMKEVVEALNRIRNGDSLENNKTDRSSSSPKEDARLLTSSIQYSPDS

Gene3D: G3DSA:2.60.120.200
IPR013320
239-339 no description
Concanavalin A-like lectin/glucanase, subgroup

SNKNRILGIVCGVAGGGLLVVSVCFFFVWRKHKRRKQARAPNGCMRSESSMQSYSKDLELGGSPHIFTYEELEEATDGFNDSRELGDGGFGTVYKGKLRDG

Seg: seg
245-261 seg

LGIVCGVAGGGLLVVSV

superfamily: SSF56112
IPR011009
289-612 Protein kinase-like (PK-like)
Protein kinase-like domain

MQSYSKDLELGGSPHIFTYEELEEATDGFNDSRELGDGGFGTVYKGKLRDGRVVAVKRLYKNNYKRVEQFINEVDILSRLLHQNLVILYGCTSRSSRDLMLVYEFIPNGTVADHVHGSRASERGLTWPRRMSIAIETAEALAYLHAVEIIHRDVKTNNILLDNSFHVKVADFGLSRLYPPEVTHVSTVPQGTPGYVDPVYHQCYKLTEKSDVYSFGVVLVELVSSKPAVDMGRSHSEINLANMALNRIQNHEVGQLVDPELGYETDGETKRSIDLVAELAFRCLQLERDSRPSMKEVVEALNRIRNGDSLENNKTDRSSSSPKE

ProfileScan: PS50011
IPR000719
317-592 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FNDSRELGDGGFGTVYKGKLRDGRVVAVKRLYKNNYKRVEQFINEVDILSRLLHQNLVILYGCTSRSSRDLMLVYEFIPNGTVADHVHGSRASERGLTWPRRMSIAIETAEALAYLHAVEIIHRDVKTNNILLDNSFHVKVADFGLSRLYPPEVTHVSTVPQGTPGYVDPVYHQCYKLTEKSDVYSFGVVLVELVSSKPAVDMGRSHSEINLANMALNRIQNHEVGQLVDPELGYETDGETKRSIDLVAELAFRCLQLERDSRPSMKEVVEALNRI

HMMSmart: SM00219
IPR020635
317-589 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FNDSRELGDGGFGTVYKGKLRDGRVVAVKRLYKNNYKRVEQFINEVDILSRLLHQNLVILYGCTSRSSRDLMLVYEFIPNGTVADHVHGSRASERGLTWPRRMSIAIETAEALAYLHAVEIIHRDVKTNNILLDNSFHVKVADFGLSRLYPPEVTHVSTVPQGTPGYVDPVYHQCYKLTEKSDVYSFGVVLVELVSSKPAVDMGRSHSEINLANMALNRIQNHEVGQLVDPELGYETDGETKRSIDLVAELAFRCLQLERDSRPSMKEVVEAL

HMMSmart: SM00220
IPR002290
317-592 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FNDSRELGDGGFGTVYKGKLRDGRVVAVKRLYKNNYKRVEQFINEVDILSRLLHQNLVILYGCTSRSSRDLMLVYEFIPNGTVADHVHGSRASERGLTWPRRMSIAIETAEALAYLHAVEIIHRDVKTNNILLDNSFHVKVADFGLSRLYPPEVTHVSTVPQGTPGYVDPVYHQCYKLTEKSDVYSFGVVLVELVSSKPAVDMGRSHSEINLANMALNRIQNHEVGQLVDPELGYETDGETKRSIDLVAELAFRCLQLERDSRPSMKEVVEALNRI

HMMPfam: PF00069
IPR017442
319-587 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

DSRELGDGGFGTVYKGKLRDGRVVAVKRLYKNNYKRVEQFINEVDILSRLLHQNLVILYGCTSRSSRDLMLVYEFIPNGTVADHVHGSRASERGLTWPRRMSIAIETAEALAYLHAVEIIHRDVKTNNILLDNSFHVKVADFGLSRLYPPEVTHVSTVPQGTPGYVDPVYHQCYKLTEKSDVYSFGVVLVELVSSKPAVDMGRSHSEINLANMALNRIQNHEVGQLVDPELGYETDGETKRSIDLVAELAFRCLQLERDSRPSMKEVVE

PatternScan: PS00107
IPR017441
323-345 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGDGGFGTVYKGKLRDGRVVAVK

Gene3D: G3DSA:3.30.200.20
340-389 no description

RVVAVKRLYKNNYKRVEQFINEVDILSRLLHQNLVILYGCTSRSSRDLML

Gene3D: G3DSA:1.10.510.10
390-587 no description

VYEFIPNGTVADHVHGSRASERGLTWPRRMSIAIETAEALAYLHAVEIIHRDVKTNNILLDNSFHVKVADFGLSRLYPPEVTHVSTVPQGTPGYVDPVYHQCYKLTEKSDVYSFGVVLVELVSSKPAVDMGRSHSEINLANMALNRIQNHEVGQLVDPELGYETDGETKRSIDLVAELAFRCLQLERDSRPSMKEVVE

PatternScan: PS00108
IPR008271
437-449 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKTNNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox